BLASTX nr result
ID: Wisteria21_contig00019956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00019956 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM40921.1| hypothetical protein LR48_Vigan04g111900 [Vigna a... 172 1e-40 ref|XP_006581683.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 171 2e-40 ref|XP_006581682.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 171 2e-40 ref|XP_006581678.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 171 2e-40 ref|XP_006577814.1| PREDICTED: uncharacterized protein LOC100786... 171 2e-40 ref|XP_007136445.1| hypothetical protein PHAVU_009G046000g [Phas... 171 2e-40 ref|XP_006577812.1| PREDICTED: uncharacterized protein LOC100786... 171 2e-40 ref|XP_003526756.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 171 2e-40 gb|ACU24484.1| unknown [Glycine max] 171 2e-40 ref|NP_001242110.1| uncharacterized protein LOC100786491 [Glycin... 171 2e-40 ref|XP_003602364.1| pre-mRNA-splicing factor SF2-like protein [M... 171 2e-40 ref|XP_011003268.1| PREDICTED: serine/arginine-rich splicing fac... 167 2e-39 ref|XP_011003267.1| PREDICTED: serine/arginine-rich splicing fac... 167 2e-39 ref|XP_011003264.1| PREDICTED: serine/arginine-rich splicing fac... 167 2e-39 ref|XP_006374084.1| hypothetical protein POPTR_0015s00690g [Popu... 167 2e-39 ref|XP_012571984.1| PREDICTED: serine/arginine-rich splicing fac... 167 2e-39 ref|XP_004502746.1| PREDICTED: serine/arginine-rich splicing fac... 167 2e-39 ref|XP_012486603.1| PREDICTED: serine/arginine-rich splicing fac... 166 5e-39 gb|KJB37416.1| hypothetical protein B456_006G203400 [Gossypium r... 166 5e-39 gb|KJB37415.1| hypothetical protein B456_006G203400 [Gossypium r... 166 5e-39 >gb|KOM40921.1| hypothetical protein LR48_Vigan04g111900 [Vigna angularis] Length = 317 Score = 172 bits (435), Expect = 1e-40 Identities = 80/81 (98%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006581683.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X7 [Glycine max] Length = 262 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006581682.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X6 [Glycine max] Length = 299 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006581678.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X2 [Glycine max] gi|571460367|ref|XP_006581679.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X3 [Glycine max] gi|571460369|ref|XP_006581680.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X4 [Glycine max] gi|571460371|ref|XP_006581681.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X5 [Glycine max] Length = 300 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006577814.1| PREDICTED: uncharacterized protein LOC100786491 isoform X3 [Glycine max] Length = 266 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_007136445.1| hypothetical protein PHAVU_009G046000g [Phaseolus vulgaris] gi|593268538|ref|XP_007136446.1| hypothetical protein PHAVU_009G046000g [Phaseolus vulgaris] gi|561009532|gb|ESW08439.1| hypothetical protein PHAVU_009G046000g [Phaseolus vulgaris] gi|561009533|gb|ESW08440.1| hypothetical protein PHAVU_009G046000g [Phaseolus vulgaris] Length = 260 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGR+MDIELKIPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRVMDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006577812.1| PREDICTED: uncharacterized protein LOC100786491 isoform X1 [Glycine max] gi|571448372|ref|XP_006577813.1| PREDICTED: uncharacterized protein LOC100786491 isoform X2 [Glycine max] gi|734370945|gb|KHN19555.1| Pre-mRNA-splicing factor SF2 [Glycine soja] gi|947116010|gb|KRH64312.1| hypothetical protein GLYMA_04G229300 [Glycine max] Length = 267 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_003526756.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Glycine max] gi|947105233|gb|KRH53616.1| hypothetical protein GLYMA_06G135500 [Glycine max] Length = 263 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >gb|ACU24484.1| unknown [Glycine max] Length = 267 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|NP_001242110.1| uncharacterized protein LOC100786491 [Glycine max] gi|255636783|gb|ACU18725.1| unknown [Glycine max] Length = 267 Score = 171 bits (434), Expect = 2e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_003602364.1| pre-mRNA-splicing factor SF2-like protein [Medicago truncatula] gi|355491412|gb|AES72615.1| pre-mRNA-splicing factor SF2-like protein [Medicago truncatula] Length = 380 Score = 171 bits (433), Expect = 2e-40 Identities = 80/89 (89%), Positives = 85/89 (95%) Frame = -3 Query: 310 TV*LLLSDMSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEF 131 TV L S+MS RFSRTIYVGNLP+DIRESEIEDLFYKYGRIM+IELK+PPRPPCYCFVEF Sbjct: 100 TVQFLQSNMSSRFSRTIYVGNLPADIRESEIEDLFYKYGRIMEIELKVPPRPPCYCFVEF 159 Query: 130 DNARDAEEAIRGRDGYNFDGCRLRVELAH 44 DNARDAE+AIRGRDGYNFDGCRLRVELAH Sbjct: 160 DNARDAEDAIRGRDGYNFDGCRLRVELAH 188 >ref|XP_011003268.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X3 [Populus euphratica] Length = 191 Score = 167 bits (424), Expect = 2e-39 Identities = 76/81 (93%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRI+D+ELKIPPRPPCYCFVEF+NARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRILDVELKIPPRPPCYCFVEFENARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_011003267.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X2 [Populus euphratica] Length = 261 Score = 167 bits (424), Expect = 2e-39 Identities = 76/81 (93%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRI+D+ELKIPPRPPCYCFVEF+NARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRILDVELKIPPRPPCYCFVEFENARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_011003264.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X1 [Populus euphratica] gi|743918519|ref|XP_011003265.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X1 [Populus euphratica] gi|743918521|ref|XP_011003266.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X1 [Populus euphratica] Length = 263 Score = 167 bits (424), Expect = 2e-39 Identities = 76/81 (93%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRI+D+ELKIPPRPPCYCFVEF+NARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRILDVELKIPPRPPCYCFVEFENARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006374084.1| hypothetical protein POPTR_0015s00690g [Populus trichocarpa] gi|550321685|gb|ERP51881.1| hypothetical protein POPTR_0015s00690g [Populus trichocarpa] Length = 260 Score = 167 bits (424), Expect = 2e-39 Identities = 76/81 (93%), Positives = 81/81 (100%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRI+D+ELKIPPRPPCYCFVEF+NARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRILDVELKIPPRPPCYCFVEFENARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_012571984.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X2 [Cicer arietinum] Length = 272 Score = 167 bits (424), Expect = 2e-39 Identities = 77/81 (95%), Positives = 80/81 (98%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MS RFSRTIYVGNLPSDIRESEIEDLFYKYGRIM+IELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSSRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMEIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_004502746.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X1 [Cicer arietinum] gi|502136601|ref|XP_004502747.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X1 [Cicer arietinum] Length = 273 Score = 167 bits (424), Expect = 2e-39 Identities = 77/81 (95%), Positives = 80/81 (98%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MS RFSRTIYVGNLPSDIRESEIEDLFYKYGRIM+IELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSSRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMEIELKVPPRPPCYCFVEFDNARDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_012486603.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like isoform X2 [Gossypium raimondii] Length = 252 Score = 166 bits (421), Expect = 5e-39 Identities = 76/81 (93%), Positives = 80/81 (98%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRE E+EDLFYKYGRI+DIELKIPPRPPCYCFVEFDN+RDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIREWEVEDLFYKYGRILDIELKIPPRPPCYCFVEFDNSRDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >gb|KJB37416.1| hypothetical protein B456_006G203400 [Gossypium raimondii] Length = 251 Score = 166 bits (421), Expect = 5e-39 Identities = 76/81 (93%), Positives = 80/81 (98%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRE E+EDLFYKYGRI+DIELKIPPRPPCYCFVEFDN+RDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIREWEVEDLFYKYGRILDIELKIPPRPPCYCFVEFDNSRDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >gb|KJB37415.1| hypothetical protein B456_006G203400 [Gossypium raimondii] Length = 248 Score = 166 bits (421), Expect = 5e-39 Identities = 76/81 (93%), Positives = 80/81 (98%) Frame = -3 Query: 286 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 107 MSGRFSRTIYVGNLPSDIRE E+EDLFYKYGRI+DIELKIPPRPPCYCFVEFDN+RDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIREWEVEDLFYKYGRILDIELKIPPRPPCYCFVEFDNSRDAED 60 Query: 106 AIRGRDGYNFDGCRLRVELAH 44 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81