BLASTX nr result
ID: Wisteria21_contig00017113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00017113 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004512861.1| PREDICTED: uncharacterized protein LOC101506... 65 2e-08 >ref|XP_004512861.1| PREDICTED: uncharacterized protein LOC101506707 [Cicer arietinum] Length = 227 Score = 65.1 bits (157), Expect = 2e-08 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 4/55 (7%) Frame = +3 Query: 99 MEECK---RKRVQDDLEADSPESK-LLRVDSDSEANSSESQLTRVNSGESCVDSD 251 MEECK RKRV++D E DSPESK ++RVDS S+ NSSE LTRVNS ES VDS+ Sbjct: 1 MEECKNDTRKRVREDSEVDSPESKRVIRVDSGSDDNSSEFHLTRVNSSESFVDSN 55