BLASTX nr result
ID: Wisteria21_contig00017050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00017050 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007155852.1| hypothetical protein PHAVU_003G237100g [Phas... 75 2e-11 gb|KOM32397.1| hypothetical protein LR48_Vigan01g195300 [Vigna a... 65 2e-08 ref|XP_003524685.1| PREDICTED: casein kinase II subunit alpha-1-... 62 2e-07 >ref|XP_007155852.1| hypothetical protein PHAVU_003G237100g [Phaseolus vulgaris] gi|561029206|gb|ESW27846.1| hypothetical protein PHAVU_003G237100g [Phaseolus vulgaris] Length = 404 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +2 Query: 185 MCNYRYTRLKYAHEPRAVLLRFLQVCTLVALRAPVAQPP 301 MCNY YTR+KYAHEP A+LLRFL VCTLVALRAPVAQPP Sbjct: 1 MCNYPYTRIKYAHEPPAILLRFLLVCTLVALRAPVAQPP 39 >gb|KOM32397.1| hypothetical protein LR48_Vigan01g195300 [Vigna angularis] Length = 404 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 185 MCNYRYTRLKYAHEPRAVLLRFLQVCTLVALRAPVAQPP 301 MC YTR+KYA+EP A+LLRFL VCTLVALRAPVAQPP Sbjct: 1 MCYCPYTRIKYANEPPALLLRFLLVCTLVALRAPVAQPP 39 >ref|XP_003524685.1| PREDICTED: casein kinase II subunit alpha-1-like [Glycine max] gi|734328595|gb|KHN06009.1| Casein kinase II subunit alpha-2 [Glycine soja] gi|947109742|gb|KRH58068.1| hypothetical protein GLYMA_05G104200 [Glycine max] Length = 411 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/37 (83%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +2 Query: 194 YRYTRLKYAHE-PRAVLLRFLQVCTLVALRAPVAQPP 301 YRYTR+KYA E P A+LLRFL VCTLVALRAPVAQPP Sbjct: 7 YRYTRIKYAQEAPPALLLRFLLVCTLVALRAPVAQPP 43