BLASTX nr result
ID: Wisteria21_contig00016765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00016765 (409 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004489683.1| PREDICTED: protein QUIRKY [Cicer arietinum] 78 2e-12 ref|XP_013451562.1| calcium-dependent lipid-binding (CaLB domain... 76 1e-11 ref|XP_013451563.1| C2 domain first repeat protein [Medicago tru... 74 3e-11 ref|XP_010454018.1| PREDICTED: uncharacterized protein LOC104735... 72 2e-10 ref|XP_010492789.1| PREDICTED: uncharacterized protein LOC104770... 72 2e-10 ref|XP_010420533.1| PREDICTED: uncharacterized protein LOC104706... 72 2e-10 ref|XP_006400340.1| hypothetical protein EUTSA_v10012529mg [Eutr... 72 2e-10 ref|XP_013722289.1| PREDICTED: protein QUIRKY-like, partial [Bra... 70 5e-10 ref|NP_197299.1| C2 calcium/lipid-binding and phosphoribosyltran... 70 5e-10 emb|CDY25472.1| BnaC09g39870D [Brassica napus] 70 5e-10 ref|XP_006286355.1| hypothetical protein CARUB_v10000107mg [Caps... 70 5e-10 ref|XP_002871792.1| C2 domain-containing protein [Arabidopsis ly... 70 6e-10 ref|XP_009121034.1| PREDICTED: uncharacterized protein LOC103845... 69 1e-09 ref|XP_008441994.1| PREDICTED: multiple C2 and transmembrane dom... 68 3e-09 ref|XP_004149122.1| PREDICTED: multiple C2 and transmembrane dom... 68 3e-09 ref|XP_009353191.1| PREDICTED: multiple C2 and transmembrane dom... 67 5e-09 emb|CDP10533.1| unnamed protein product [Coffea canephora] 67 5e-09 ref|XP_012070423.1| PREDICTED: uncharacterized protein LOC105632... 67 5e-09 gb|KDO54987.1| hypothetical protein CISIN_1g001521mg [Citrus sin... 67 5e-09 ref|XP_013722301.1| PREDICTED: protein QUIRKY-like isoform X4 [B... 67 7e-09 >ref|XP_004489683.1| PREDICTED: protein QUIRKY [Cicer arietinum] Length = 1022 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFVRKGEEALIYYELKKK+LFNMVQG+VGLKIYY D Sbjct: 94 RLGSTQFVRKGEEALIYYELKKKNLFNMVQGKVGLKIYYVD 134 >ref|XP_013451562.1| calcium-dependent lipid-binding (CaLB domain) family protein [Medicago truncatula] gi|657381619|gb|KEH25590.1| calcium-dependent lipid-binding (CaLB domain) family protein [Medicago truncatula] Length = 1026 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RL S QFV+KGEEALIYYELKKKSLFNMVQG+VGLKIYY D Sbjct: 94 RLSSTQFVKKGEEALIYYELKKKSLFNMVQGKVGLKIYYVD 134 >ref|XP_013451563.1| C2 domain first repeat protein [Medicago truncatula] gi|657381620|gb|KEH25591.1| C2 domain first repeat protein [Medicago truncatula] Length = 212 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RL S QFV+KGEEALIYYELKKKSLFNMV+G+VGLKIYY D Sbjct: 94 RLSSTQFVKKGEEALIYYELKKKSLFNMVRGKVGLKIYYVD 134 >ref|XP_010454018.1| PREDICTED: uncharacterized protein LOC104735852 [Camelina sativa] Length = 1052 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIYY L+KKSLFN+VQGE+GL++YYAD Sbjct: 96 RLGSDQFVGKGEEALIYYRLEKKSLFNLVQGEIGLRLYYAD 136 >ref|XP_010492789.1| PREDICTED: uncharacterized protein LOC104770124 [Camelina sativa] Length = 1051 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIYY L+KKSLFN+VQGE+GL++YYAD Sbjct: 96 RLGSDQFVGKGEEALIYYPLEKKSLFNLVQGEIGLRLYYAD 136 >ref|XP_010420533.1| PREDICTED: uncharacterized protein LOC104706100 [Camelina sativa] Length = 1053 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIYY L+KKSLFN+VQGE+GL++YYAD Sbjct: 96 RLGSDQFVGKGEEALIYYPLEKKSLFNLVQGEIGLRLYYAD 136 >ref|XP_006400340.1| hypothetical protein EUTSA_v10012529mg [Eutrema salsugineum] gi|557101430|gb|ESQ41793.1| hypothetical protein EUTSA_v10012529mg [Eutrema salsugineum] Length = 1064 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIYY L+KKSLFN+VQGE+G++IYYAD Sbjct: 96 RLGSDQFVGKGEEALIYYPLEKKSLFNLVQGEIGIRIYYAD 136 >ref|XP_013722289.1| PREDICTED: protein QUIRKY-like, partial [Brassica napus] Length = 978 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIY+ L+KKSLFN+VQGE+G++IYYAD Sbjct: 24 RLGSDQFVAKGEEALIYFPLEKKSLFNLVQGEIGIRIYYAD 64 >ref|NP_197299.1| C2 calcium/lipid-binding and phosphoribosyltransferase C-terminal domain-containing protein [Arabidopsis thaliana] gi|9757890|dbj|BAB08397.1| phosphoribosylanthranilate transferase-like protein [Arabidopsis thaliana] gi|332005109|gb|AED92492.1| C2 calcium/lipid-binding and phosphoribosyltransferase C-terminal domain-containing protein [Arabidopsis thaliana] Length = 1049 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV +GEEALIYY L+KKSLFN+VQGE+GL++YYAD Sbjct: 96 RLGSDQFVGQGEEALIYYPLEKKSLFNLVQGEIGLRVYYAD 136 >emb|CDY25472.1| BnaC09g39870D [Brassica napus] Length = 1001 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIY+ L+KKSLFN+VQGE+G++IYYAD Sbjct: 96 RLGSDQFVAKGEEALIYFPLEKKSLFNLVQGEIGIRIYYAD 136 >ref|XP_006286355.1| hypothetical protein CARUB_v10000107mg [Capsella rubella] gi|482555061|gb|EOA19253.1| hypothetical protein CARUB_v10000107mg [Capsella rubella] Length = 1055 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIY+ L+KKSLFN+VQGE+GL++YYAD Sbjct: 96 RLGSDQFVGKGEEALIYFPLEKKSLFNLVQGEIGLRVYYAD 136 >ref|XP_002871792.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317629|gb|EFH48051.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1053 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLG QFV KGEEALIYY L+KKSLFN+VQGE+GL++YYAD Sbjct: 96 RLGPDQFVGKGEEALIYYPLEKKSLFNLVQGEIGLRVYYAD 136 >ref|XP_009121034.1| PREDICTED: uncharacterized protein LOC103845885 [Brassica rapa] Length = 1050 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIY+ L+KKSLFN+VQGE+G++IYYA+ Sbjct: 96 RLGSDQFVAKGEEALIYFPLEKKSLFNLVQGEIGIRIYYAE 136 >ref|XP_008441994.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2 [Cucumis melo] Length = 1069 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RL S QFV+KGEEALIY+ L+KKSLF+ +QGE+GLKIYY+D Sbjct: 96 RLSSTQFVKKGEEALIYFHLEKKSLFSWIQGEIGLKIYYSD 136 >ref|XP_004149122.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2 [Cucumis sativus] gi|700198767|gb|KGN53925.1| Phosphoribosylanthranilate transferase-like protein [Cucumis sativus] Length = 1057 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RL S QFV+KGEEALIY+ L+KKSLF+ +QGE+GLKIYY+D Sbjct: 96 RLSSTQFVKKGEEALIYFRLEKKSLFSWIQGEIGLKIYYSD 136 >ref|XP_009353191.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Pyrus x bretschneideri] Length = 566 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RL S QFV+KGEEALIY+ L+KKSLF+ +QGE+GLKIYY D Sbjct: 94 RLSSTQFVKKGEEALIYFPLEKKSLFSWIQGEIGLKIYYVD 134 >emb|CDP10533.1| unnamed protein product [Coffea canephora] Length = 1067 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 +L S QFVRKGEEALIYY L+KK+LF+ +QGE+GLKIY+AD Sbjct: 94 KLSSRQFVRKGEEALIYYPLEKKTLFSWIQGEIGLKIYFAD 134 >ref|XP_012070423.1| PREDICTED: uncharacterized protein LOC105632606 [Jatropha curcas] gi|643732585|gb|KDP39681.1| hypothetical protein JCGZ_02701 [Jatropha curcas] Length = 1063 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RL S QFVRKGEEALIYY L+KK LF+ +QGE+GLKIYY D Sbjct: 94 RLNSTQFVRKGEEALIYYPLEKKYLFSWIQGEIGLKIYYQD 134 >gb|KDO54987.1| hypothetical protein CISIN_1g001521mg [Citrus sinensis] Length = 1061 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RL S+QFV+KGEEALIYY L+KKSL + +QGEVGLKIYY D Sbjct: 94 RLSSSQFVKKGEEALIYYPLEKKSLLSWIQGEVGLKIYYVD 134 >ref|XP_013722301.1| PREDICTED: protein QUIRKY-like isoform X4 [Brassica napus] Length = 1051 Score = 66.6 bits (161), Expect = 7e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 407 RLGSAQFVRKGEEALIYYELKKKSLFNMVQGEVGLKIYYAD 285 RLGS QFV KGEEALIY+ L+KKSLF +VQGE+G++IYYA+ Sbjct: 96 RLGSDQFVAKGEEALIYFPLEKKSLFTLVQGEIGIRIYYAE 136