BLASTX nr result
ID: Wisteria21_contig00016710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00016710 (413 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004509026.1| PREDICTED: AT-hook motif nuclear-localized p... 65 2e-08 >ref|XP_004509026.1| PREDICTED: AT-hook motif nuclear-localized protein 8-like [Cicer arietinum] Length = 342 Score = 65.5 bits (158), Expect = 2e-08 Identities = 39/68 (57%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = -2 Query: 199 MDSRGAPP--TMMAGPTSYAPTNSTMISPNSSATIMAQATARFXXXXXXXXXXXXXXXXX 26 MDSR PP MM GPTSY PTNS+MISPNSS IMA ATARF Sbjct: 1 MDSRSVPPPSNMMVGPTSYTPTNSSMISPNSSTNIMAPATARF----PFNSPQTSEPFSV 56 Query: 25 THDGTSSP 2 THDG SSP Sbjct: 57 THDGPSSP 64