BLASTX nr result
ID: Wisteria21_contig00016638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00016638 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088916.1| hypothetical protein L484_018543 [Morus nota... 57 7e-06 >ref|XP_010088916.1| hypothetical protein L484_018543 [Morus notabilis] gi|587846655|gb|EXB37120.1| hypothetical protein L484_018543 [Morus notabilis] Length = 240 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = +1 Query: 70 GSCILFSSRELPDRRSIRNGLRVHFVGRNDPQSIRGFGEPKEVF 201 GS ILFSS+EL DRRSIRNGLRVHFVGR DP G PK F Sbjct: 194 GSSILFSSQELLDRRSIRNGLRVHFVGRKDPIH---SGNPKTKF 234