BLASTX nr result
ID: Wisteria21_contig00016234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00016234 (351 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013467138.1| plant-specific B3-DNA-binding domain protein... 107 5e-26 ref|XP_013467147.1| plant-specific B3-DNA-binding domain protein... 97 2e-24 ref|XP_013467148.1| plant-specific B3-DNA-binding domain protein... 98 4e-24 ref|XP_004497762.1| PREDICTED: B3 domain-containing protein REM2... 96 2e-23 ref|XP_013461301.1| B3 DNA-binding domain protein [Medicago trun... 94 5e-23 ref|XP_003539036.1| PREDICTED: B3 domain-containing protein At5g... 77 5e-19 ref|XP_007131904.1| hypothetical protein PHAVU_011G050500g [Phas... 79 5e-18 ref|XP_003541119.2| PREDICTED: B3 domain-containing protein REM2... 73 7e-18 ref|XP_006592123.1| PREDICTED: B3 domain-containing protein REM2... 73 7e-18 gb|KRH24552.1| hypothetical protein GLYMA_12G048500 [Glycine max] 73 7e-18 gb|ACU23634.1| unknown [Glycine max] 73 7e-18 ref|XP_014521864.1| PREDICTED: B3 domain-containing protein REM2... 78 2e-17 gb|KOM50843.1| hypothetical protein LR48_Vigan08g167000 [Vigna a... 76 4e-16 ref|XP_007141725.1| hypothetical protein PHAVU_008G220000g [Phas... 69 1e-13 ref|XP_014502983.1| PREDICTED: B3 domain-containing protein REM2... 73 2e-13 ref|XP_006595849.1| PREDICTED: B3 domain-containing protein REM2... 70 2e-11 emb|CAN82365.1| hypothetical protein VITISV_027616 [Vitis vinifera] 69 1e-10 ref|XP_010647813.1| PREDICTED: B3 domain-containing protein REM2... 69 1e-10 ref|XP_010647819.1| PREDICTED: putative B3 domain-containing pro... 69 1e-10 gb|KHN48598.1| B3 domain-containing protein REM21 [Glycine soja] 70 5e-10 >ref|XP_013467138.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula] gi|657402276|gb|KEH41174.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula] Length = 324 Score = 107 bits (267), Expect(2) = 5e-26 Identities = 49/65 (75%), Positives = 57/65 (87%) Frame = +1 Query: 157 VEDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKI 336 ++DFILRDR GR WHVKAR IGD+LYFDGGWK+FRE NSLE DF+VFTH+ + VF+FKI Sbjct: 38 IKDFILRDRRGRDWHVKARLIGDELYFDGGWKQFREENSLEEDDFLVFTHIENTVFRFKI 97 Query: 337 LELSS 351 LELSS Sbjct: 98 LELSS 102 Score = 37.0 bits (84), Expect(2) = 5e-26 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +3 Query: 75 VAKKYPDFFKVFLPERHSERM 137 +AK YPDFFKVF E+H+ERM Sbjct: 1 MAKDYPDFFKVFSTEKHTERM 21 >ref|XP_013467147.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula] gi|657402285|gb|KEH41183.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula] Length = 337 Score = 97.1 bits (240), Expect(2) = 2e-24 Identities = 44/65 (67%), Positives = 53/65 (81%) Frame = +1 Query: 157 VEDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKI 336 ++DFILRDR R W+VKAR IGD+ YFD GWK+FR+ N L DF+VFTH+ +NVFKFKI Sbjct: 41 IKDFILRDRRRRDWYVKARRIGDEFYFDDGWKKFRQENCLVENDFLVFTHIENNVFKFKI 100 Query: 337 LELSS 351 LELSS Sbjct: 101 LELSS 105 Score = 42.0 bits (97), Expect(2) = 2e-24 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +3 Query: 63 MTNNVAKKYPDFFKVFLPERHSERM 137 MTNN AK+YP FFKVFL E+HSERM Sbjct: 1 MTNN-AKEYPGFFKVFLKEKHSERM 24 >ref|XP_013467148.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula] gi|657402286|gb|KEH41184.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula] Length = 335 Score = 98.2 bits (243), Expect(2) = 4e-24 Identities = 46/65 (70%), Positives = 52/65 (80%) Frame = +1 Query: 157 VEDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKI 336 ++DFILRD G WHVK IG+KLYFD GWK FRE NSLE DF+VFTH+ +NVFKFKI Sbjct: 41 LKDFILRDHRGSDWHVKVCSIGNKLYFDDGWKLFREENSLEDNDFLVFTHIENNVFKFKI 100 Query: 337 LELSS 351 LELSS Sbjct: 101 LELSS 105 Score = 40.0 bits (92), Expect(2) = 4e-24 Identities = 18/25 (72%), Positives = 23/25 (92%) Frame = +3 Query: 63 MTNNVAKKYPDFFKVFLPERHSERM 137 MTNN AK+YP+FFKVFL ++HS+RM Sbjct: 1 MTNN-AKEYPNFFKVFLTKKHSDRM 24 >ref|XP_004497762.1| PREDICTED: B3 domain-containing protein REM20-like [Cicer arietinum] Length = 331 Score = 95.5 bits (236), Expect(2) = 2e-23 Identities = 45/65 (69%), Positives = 50/65 (76%) Frame = +1 Query: 157 VEDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKI 336 ++D LRD GR WHVK R +G KLYF GWKRFRE N LE DFIVFTHV +NVFKFKI Sbjct: 41 MKDVTLRDHRGREWHVKTRSVGAKLYFADGWKRFREQNCLEESDFIVFTHVENNVFKFKI 100 Query: 337 LELSS 351 LEL+S Sbjct: 101 LELAS 105 Score = 40.0 bits (92), Expect(2) = 2e-23 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +3 Query: 72 NVAKKYPDFFKVFLPERHSERM 137 NV K+YPDFFKVFL E+H ERM Sbjct: 3 NVTKEYPDFFKVFLLEKHYERM 24 >ref|XP_013461301.1| B3 DNA-binding domain protein [Medicago truncatula] gi|657394864|gb|KEH35336.1| B3 DNA-binding domain protein [Medicago truncatula] Length = 248 Score = 94.4 bits (233), Expect(2) = 5e-23 Identities = 45/62 (72%), Positives = 48/62 (77%) Frame = +1 Query: 166 FILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKILEL 345 FILRD G WHVKAR IG KLYFD GWK FRE NSLE DF+VF H+ +NVFKFKI EL Sbjct: 55 FILRDHRGTDWHVKARSIGRKLYFDDGWKLFREENSLEDNDFLVFRHIENNVFKFKIYEL 114 Query: 346 SS 351 SS Sbjct: 115 SS 116 Score = 40.0 bits (92), Expect(2) = 5e-23 Identities = 19/33 (57%), Positives = 22/33 (66%) Frame = +3 Query: 39 SARDKR*PMTNNVAKKYPDFFKVFLPERHSERM 137 S K +T N AK +PDFFKVFL E+H ERM Sbjct: 3 SIHSKDNQITTNTAKLFPDFFKVFLIEKHYERM 35 >ref|XP_003539036.1| PREDICTED: B3 domain-containing protein At5g60130-like isoform X1 [Glycine max] gi|571488397|ref|XP_006590923.1| PREDICTED: B3 domain-containing protein At5g60130-like isoform X2 [Glycine max] gi|571488399|ref|XP_006590924.1| PREDICTED: B3 domain-containing protein At5g60130-like isoform X3 [Glycine max] gi|571488401|ref|XP_006590925.1| PREDICTED: B3 domain-containing protein At5g60130-like isoform X4 [Glycine max] gi|571488403|ref|XP_006590926.1| PREDICTED: B3 domain-containing protein At5g60130-like isoform X5 [Glycine max] gi|571488405|ref|XP_006590927.1| PREDICTED: B3 domain-containing protein At5g60130-like isoform X6 [Glycine max] gi|734329278|gb|KHN06185.1| B3 domain-containing protein REM21 [Glycine soja] gi|947080794|gb|KRH29583.1| hypothetical protein GLYMA_11G125200 [Glycine max] gi|947080795|gb|KRH29584.1| hypothetical protein GLYMA_11G125200 [Glycine max] gi|947080796|gb|KRH29585.1| hypothetical protein GLYMA_11G125200 [Glycine max] gi|947080797|gb|KRH29586.1| hypothetical protein GLYMA_11G125200 [Glycine max] gi|947080798|gb|KRH29587.1| hypothetical protein GLYMA_11G125200 [Glycine max] gi|947080799|gb|KRH29588.1| hypothetical protein GLYMA_11G125200 [Glycine max] gi|947080800|gb|KRH29589.1| hypothetical protein GLYMA_11G125200 [Glycine max] gi|947080801|gb|KRH29590.1| hypothetical protein GLYMA_11G125200 [Glycine max] Length = 336 Score = 77.0 bits (188), Expect(2) = 5e-19 Identities = 39/64 (60%), Positives = 43/64 (67%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED ILR+ SGRVW VK R IG+KLYFD GW F E N L DF+VF H SN FK IL Sbjct: 42 EDVILRNISGRVWQVKTRYIGEKLYFDDGWNAFHEENCLGHADFLVFKHDRSNEFKVLIL 101 Query: 340 ELSS 351 E S+ Sbjct: 102 ESST 105 Score = 43.9 bits (102), Expect(2) = 5e-19 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 A++YPDFFKVFLPERHSERM Sbjct: 5 AERYPDFFKVFLPERHSERM 24 >ref|XP_007131904.1| hypothetical protein PHAVU_011G050500g [Phaseolus vulgaris] gi|561004904|gb|ESW03898.1| hypothetical protein PHAVU_011G050500g [Phaseolus vulgaris] Length = 364 Score = 79.3 bits (194), Expect(2) = 5e-18 Identities = 38/64 (59%), Positives = 45/64 (70%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED +LR+RS RVWHVK R GDKLYFD GWK F E N L DF+VF + G N F+ IL Sbjct: 41 EDVLLRNRSERVWHVKTRFFGDKLYFDDGWKIFHEENCLGNADFLVFRYDGVNEFRVTIL 100 Query: 340 ELSS 351 E+S+ Sbjct: 101 EIST 104 Score = 38.1 bits (87), Expect(2) = 5e-18 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 A+KYPDFFKVFL E+H ERM Sbjct: 4 AEKYPDFFKVFLQEQHYERM 23 >ref|XP_003541119.2| PREDICTED: B3 domain-containing protein REM20 isoform X1 [Glycine max] gi|734387566|gb|KHN25329.1| B3 domain-containing protein REM21 [Glycine soja] gi|947075711|gb|KRH24551.1| hypothetical protein GLYMA_12G048500 [Glycine max] Length = 310 Score = 73.2 bits (178), Expect(2) = 7e-18 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED ILR+ SGRVWHVK R +G+KLYFD GW+ F + N L DF+VF N F IL Sbjct: 42 EDVILRNASGRVWHVKTRYVGEKLYFDDGWRAFHQENCLGQADFLVFKLERRNEFVVLIL 101 Query: 340 ELSS 351 +LS+ Sbjct: 102 QLST 105 Score = 43.9 bits (102), Expect(2) = 7e-18 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 A++YPDFFKVFLPERHSERM Sbjct: 5 AQRYPDFFKVFLPERHSERM 24 >ref|XP_006592123.1| PREDICTED: B3 domain-containing protein REM20 isoform X2 [Glycine max] gi|947075710|gb|KRH24550.1| hypothetical protein GLYMA_12G048500 [Glycine max] Length = 299 Score = 73.2 bits (178), Expect(2) = 7e-18 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED ILR+ SGRVWHVK R +G+KLYFD GW+ F + N L DF+VF N F IL Sbjct: 31 EDVILRNASGRVWHVKTRYVGEKLYFDDGWRAFHQENCLGQADFLVFKLERRNEFVVLIL 90 Query: 340 ELSS 351 +LS+ Sbjct: 91 QLST 94 Score = 43.9 bits (102), Expect(2) = 7e-18 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 A++YPDFFKVFLPERHSERM Sbjct: 5 AQRYPDFFKVFLPERHSERM 24 >gb|KRH24552.1| hypothetical protein GLYMA_12G048500 [Glycine max] Length = 232 Score = 73.2 bits (178), Expect(2) = 7e-18 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED ILR+ SGRVWHVK R +G+KLYFD GW+ F + N L DF+VF N F IL Sbjct: 42 EDVILRNASGRVWHVKTRYVGEKLYFDDGWRAFHQENCLGQADFLVFKLERRNEFVVLIL 101 Query: 340 ELSS 351 +LS+ Sbjct: 102 QLST 105 Score = 43.9 bits (102), Expect(2) = 7e-18 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 A++YPDFFKVFLPERHSERM Sbjct: 5 AQRYPDFFKVFLPERHSERM 24 >gb|ACU23634.1| unknown [Glycine max] Length = 202 Score = 73.2 bits (178), Expect(2) = 7e-18 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED ILR+ SGRVWHVK R +G+KLYFD GW+ F + N L DF+VF N F IL Sbjct: 42 EDVILRNASGRVWHVKTRYVGEKLYFDDGWRAFHQENCLGQADFLVFKLERRNEFVVLIL 101 Query: 340 ELSS 351 +LS+ Sbjct: 102 QLST 105 Score = 43.9 bits (102), Expect(2) = 7e-18 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 A++YPDFFKVFLPERHSERM Sbjct: 5 AQRYPDFFKVFLPERHSERM 24 >ref|XP_014521864.1| PREDICTED: B3 domain-containing protein REM20-like [Vigna radiata var. radiata] Length = 355 Score = 77.8 bits (190), Expect(2) = 2e-17 Identities = 37/64 (57%), Positives = 45/64 (70%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED +LR+ S RVWHVK R GD+LYFD GWK FRE N L DF++F + G N F+ KIL Sbjct: 41 EDVLLRNSSERVWHVKTRFFGDRLYFDEGWKIFREENCLRNVDFLIFRYDGVNEFRVKIL 100 Query: 340 ELSS 351 E S+ Sbjct: 101 EKST 104 Score = 37.7 bits (86), Expect(2) = 2e-17 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +3 Query: 81 KKYPDFFKVFLPERHSERM 137 ++YPDFFKVFL E+HSERM Sbjct: 5 ERYPDFFKVFLQEQHSERM 23 >gb|KOM50843.1| hypothetical protein LR48_Vigan08g167000 [Vigna angularis] Length = 245 Score = 75.9 bits (185), Expect(2) = 4e-16 Identities = 36/64 (56%), Positives = 44/64 (68%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED +LR+ S RVWHVK R GD+LYFD GWK F E N L DF++F + G N F+ KIL Sbjct: 41 EDVLLRNSSERVWHVKTRFFGDRLYFDEGWKIFHEENCLRNVDFLIFRYDGVNEFRVKIL 100 Query: 340 ELSS 351 E S+ Sbjct: 101 ERST 104 Score = 35.4 bits (80), Expect(2) = 4e-16 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 A++YPDFFKVFL E+H ER+ Sbjct: 4 AERYPDFFKVFLQEQHLERI 23 >ref|XP_007141725.1| hypothetical protein PHAVU_008G220000g [Phaseolus vulgaris] gi|561014858|gb|ESW13719.1| hypothetical protein PHAVU_008G220000g [Phaseolus vulgaris] Length = 331 Score = 69.3 bits (168), Expect(2) = 1e-13 Identities = 34/64 (53%), Positives = 43/64 (67%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED ILR+ SG VW VK R +G K+YF GWK F+ N + DF++F + G+NVFK IL Sbjct: 41 EDIILRNVSGGVWCVKTRLVGHKIYFQEGWKVFQAENCIGKADFLLFKYDGTNVFKVVIL 100 Query: 340 ELSS 351 E SS Sbjct: 101 EQSS 104 Score = 33.5 bits (75), Expect(2) = 1e-13 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 AKKY FFK+F PE+HSERM Sbjct: 5 AKKY--FFKIFFPEKHSERM 22 >ref|XP_014502983.1| PREDICTED: B3 domain-containing protein REM20-like [Vigna radiata var. radiata] Length = 353 Score = 73.2 bits (178), Expect(2) = 2e-13 Identities = 35/64 (54%), Positives = 45/64 (70%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 +D ILR+ SGRVW VK R +G K+YF GWK F+E N + DF++F + G+NVFK IL Sbjct: 73 KDIILRNVSGRVWCVKTRLVGQKMYFGEGWKVFQEENCIRKADFMLFKYDGTNVFKVVIL 132 Query: 340 ELSS 351 E SS Sbjct: 133 EQSS 136 Score = 28.9 bits (63), Expect(2) = 2e-13 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 AK+Y FFK+F PE+HSE M Sbjct: 37 AKEY--FFKIFSPEKHSETM 54 >ref|XP_006595849.1| PREDICTED: B3 domain-containing protein REM20-like [Glycine max] gi|947065756|gb|KRH14899.1| hypothetical protein GLYMA_14G055700 [Glycine max] Length = 317 Score = 70.5 bits (171), Expect(2) = 2e-11 Identities = 33/64 (51%), Positives = 45/64 (70%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED IL + RVW+VK R +G+K+YF+ GWK F+E N L D++VF + G+N+FK IL Sbjct: 39 EDVILTNVGRRVWNVKTRLVGNKIYFEEGWKVFQEENFLGKEDYLVFKYDGANIFKVVIL 98 Query: 340 ELSS 351 E SS Sbjct: 99 EQSS 102 Score = 25.0 bits (53), Expect(2) = 2e-11 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 78 AKKYPDFFKVFLPERHSERM 137 AKKY F VF PE HSE M Sbjct: 3 AKKY--FVTVFKPEEHSESM 20 >emb|CAN82365.1| hypothetical protein VITISV_027616 [Vitis vinifera] Length = 844 Score = 68.6 bits (166), Expect(2) = 1e-10 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 E ILRD GRVWHV+ PIG +YF GW++F NS+E DF+VF + G+ +F FK+L Sbjct: 134 EKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTENSVEEGDFLVFRYAGNCIFDFKLL 193 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 90 PDFFKVFLPERHSERM 137 PDFF V+LPE +R+ Sbjct: 103 PDFFTVYLPELSWDRL 118 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = +1 Query: 169 ILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKI 336 ILRD GRVW V+ IG +YF GW++F N +E DF+VF + G +F FK+ Sbjct: 506 ILRDPVGRVWQVELSKIGKDVYFQKGWQKFVTDNFVEMEDFLVFRYDGGYIFDFKL 561 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 90 PDFFKVFLPERHSERM 137 P+FFKV LPE S+++ Sbjct: 472 PEFFKVCLPECSSDKL 487 >ref|XP_010647813.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 [Vitis vinifera] gi|731383523|ref|XP_010647814.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 [Vitis vinifera] gi|731383525|ref|XP_010647815.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 [Vitis vinifera] gi|731383527|ref|XP_010647816.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 [Vitis vinifera] gi|731383529|ref|XP_010647817.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 [Vitis vinifera] gi|731383531|ref|XP_010647818.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 [Vitis vinifera] Length = 353 Score = 68.6 bits (166), Expect(2) = 1e-10 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 E ILRD GRVWHV+ PIG +YF GW++F NS+E DF+VF + G+ +F FK+L Sbjct: 40 EKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTENSVEEGDFLVFRYAGNCIFDFKLL 99 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 90 PDFFKVFLPERHSERM 137 PDFF V+LPE +R+ Sbjct: 9 PDFFTVYLPELSWDRL 24 >ref|XP_010647819.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform X2 [Vitis vinifera] Length = 325 Score = 68.6 bits (166), Expect(2) = 1e-10 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 E ILRD GRVWHV+ PIG +YF GW++F NS+E DF+VF + G+ +F FK+L Sbjct: 40 EKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTENSVEEGDFLVFRYAGNCIFDFKLL 99 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 90 PDFFKVFLPERHSERM 137 PDFF V+LPE +R+ Sbjct: 9 PDFFTVYLPELSWDRL 24 >gb|KHN48598.1| B3 domain-containing protein REM21 [Glycine soja] Length = 354 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/64 (51%), Positives = 45/64 (70%) Frame = +1 Query: 160 EDFILRDRSGRVWHVKARPIGDKLYFDGGWKRFREGNSLEARDFIVFTHVGSNVFKFKIL 339 ED IL + RVW+VK R +G+K+YF+ GWK F+E N L D++VF + G+N+FK IL Sbjct: 76 EDVILTNVGRRVWNVKTRLVGNKIYFEEGWKVFQEENFLGKEDYLVFKYDGANIFKVVIL 135 Query: 340 ELSS 351 E SS Sbjct: 136 EQSS 139