BLASTX nr result
ID: Wisteria21_contig00015696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00015696 (553 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004502784.1| PREDICTED: neurofilament light polypeptide-l... 72 2e-10 ref|XP_003602429.1| hypothetical protein MTR_3g093260 [Medicago ... 64 6e-08 >ref|XP_004502784.1| PREDICTED: neurofilament light polypeptide-like [Cicer arietinum] Length = 99 Score = 71.6 bits (174), Expect = 2e-10 Identities = 40/57 (70%), Positives = 41/57 (71%) Frame = -3 Query: 467 MGGCVSSPKDLALNEGEAAPVESPNTPKNAEGETVAQENTXXXXXXXXXXEPLVDVS 297 MGGCVSSPKDL LNEGEAAPVESP TPK AE ETV QE T EPLVDV+ Sbjct: 1 MGGCVSSPKDLELNEGEAAPVESPTTPKAAECETVVQETT--EEAVEEKNEPLVDVT 55 >ref|XP_003602429.1| hypothetical protein MTR_3g093260 [Medicago truncatula] gi|355491477|gb|AES72680.1| hypothetical protein MTR_3g093260 [Medicago truncatula] Length = 98 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 467 MGGCVSSPKDLALNEGEAAPVESPNTPKNAEGETVAQENT 348 MGGCVS+PKD A+NEGEA PVE P +PK A+GETVAQEN+ Sbjct: 1 MGGCVSTPKDFAVNEGEA-PVEVPTSPKKADGETVAQENS 39