BLASTX nr result
ID: Wisteria21_contig00015296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00015296 (448 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007145284.1| hypothetical protein PHAVU_007G226100g [Phas... 60 6e-07 >ref|XP_007145284.1| hypothetical protein PHAVU_007G226100g [Phaseolus vulgaris] gi|561018474|gb|ESW17278.1| hypothetical protein PHAVU_007G226100g [Phaseolus vulgaris] Length = 203 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 446 GAFLQKYKKLRLAYHRKSLISLAAKTSNV*TPHKEYEN 333 GAF+QKYKKLR AYHRKSLI+LAAKTSN+ H E +N Sbjct: 166 GAFMQKYKKLRTAYHRKSLINLAAKTSNIRASHSEIKN 203