BLASTX nr result
ID: Wisteria21_contig00015127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00015127 (213 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH21810.1| hypothetical protein GLYMA_13G260000 [Glycine max] 60 8e-07 >gb|KRH21810.1| hypothetical protein GLYMA_13G260000 [Glycine max] Length = 234 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = -3 Query: 145 ITKPICTKMASQVCETLAFINSDVDGVRGMEVLEINGALLMSLMEE 8 + K ICTKMASQVCETLAFIN D DG L+INGALLMSLMEE Sbjct: 61 LIKSICTKMASQVCETLAFINGD-DG------LKINGALLMSLMEE 99