BLASTX nr result
ID: Wisteria21_contig00013599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00013599 (233 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007138464.1| hypothetical protein PHAVU_009G211300g, part... 57 7e-06 >ref|XP_007138464.1| hypothetical protein PHAVU_009G211300g, partial [Phaseolus vulgaris] gi|561011551|gb|ESW10458.1| hypothetical protein PHAVU_009G211300g, partial [Phaseolus vulgaris] Length = 223 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 8/58 (13%) Frame = -3 Query: 228 LIHWWWVDWRFINWWWFH----SWWRLIGGGRLICGWLLNW----WRFISGWFVVISQ 79 L+HWW + W F+NWW+F+ WW L G L+ W LNW WRF V++S+ Sbjct: 166 LVHWWLLYWGFVNWWFFNWGLVHWWLLYWG--LVHWWFLNWGLVNWRFFYWGLVIVSK 221