BLASTX nr result
ID: Wisteria21_contig00013582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00013582 (541 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 87 6e-15 ref|XP_014493496.1| PREDICTED: mitochondrial import receptor sub... 86 8e-15 ref|XP_013456331.1| import receptor subunit TOM6-like protein [M... 86 1e-14 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 85 2e-14 ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phas... 85 2e-14 ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 84 3e-14 ref|XP_012568946.1| PREDICTED: mitochondrial import receptor sub... 83 7e-14 ref|XP_012458101.1| PREDICTED: mitochondrial import receptor sub... 82 1e-13 gb|KHF97675.1| Mitochondrial import receptor subunit TOM6 -like ... 82 1e-13 ref|XP_009798301.1| PREDICTED: mitochondrial import receptor sub... 82 1e-13 ref|XP_004154290.1| PREDICTED: mitochondrial import receptor sub... 82 1e-13 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 82 1e-13 ref|XP_012568945.1| PREDICTED: uncharacterized protein LOC101499... 82 2e-13 ref|XP_010096240.1| hypothetical protein L484_026977 [Morus nota... 82 2e-13 ref|XP_012458102.1| PREDICTED: mitochondrial import receptor sub... 81 3e-13 gb|KHG18108.1| Mitochondrial import receptor subunit TOM6 -like ... 81 3e-13 ref|XP_007019163.1| Translocase of the outer mitochondrial membr... 81 3e-13 ref|XP_011092754.1| PREDICTED: mitochondrial import receptor sub... 81 3e-13 ref|XP_009596562.1| PREDICTED: mitochondrial import receptor sub... 80 5e-13 ref|XP_009618631.1| PREDICTED: mitochondrial import receptor sub... 80 5e-13 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] gi|734387577|gb|KHN25340.1| Mitochondrial import receptor subunit TOM6 like [Glycine soja] gi|947075691|gb|KRH24531.1| hypothetical protein GLYMA_12G047200 [Glycine max] Length = 54 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLKSH AMFGTWVVVIRVTPY+LHF Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHF 42 >ref|XP_014493496.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Vigna radiata var. radiata] gi|920708858|gb|KOM50855.1| hypothetical protein LR48_Vigan08g168200 [Vigna angularis] Length = 54 Score = 86.3 bits (212), Expect = 8e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLKSHVAMFG WVVVIRVTPY+LHF Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGAWVVVIRVTPYVLHF 42 >ref|XP_013456331.1| import receptor subunit TOM6-like protein [Medicago truncatula] gi|657388427|gb|KEH30362.1| import receptor subunit TOM6-like protein [Medicago truncatula] Length = 54 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK ALKQLKSHVAMFGTWV+VIR+TPYILHF Sbjct: 1 MFPGMFMRKPDKAVALKQLKSHVAMFGTWVLVIRITPYILHF 42 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] gi|734329252|gb|KHN06159.1| Mitochondrial import receptor subunit TOM6 like [Glycine soja] gi|947080746|gb|KRH29535.1| hypothetical protein GLYMA_11G122300 [Glycine max] gi|947080747|gb|KRH29536.1| hypothetical protein GLYMA_11G122300 [Glycine max] Length = 54 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLKSH AMFG WVVVIRVTPY+LHF Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGAWVVVIRVTPYVLHF 42 >ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] gi|561004882|gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLKSHV MFG WVVVIRVTPY+LHF Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVTMFGAWVVVIRVTPYVLHF 42 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFM+KPDK AALKQL+SHVAMFGTWVVVIRVTPY+LH+ Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHY 42 >ref|XP_012568946.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Cicer arietinum] Length = 54 Score = 83.2 bits (204), Expect = 7e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLKSHVAMFGTWVVVIRV PYIL++ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGTWVVVIRVAPYILYY 42 >ref|XP_012458101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|763810990|gb|KJB77892.1| hypothetical protein B456_012G163800 [Gossypium raimondii] Length = 54 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLK+HVAMFG WV V+RVTPYILH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHY 42 >gb|KHF97675.1| Mitochondrial import receptor subunit TOM6 -like protein [Gossypium arboreum] Length = 93 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLK+HVAMFG WV V+RVTPYILH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHY 42 >ref|XP_009798301.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] Length = 54 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPG+FMRKPDK AALKQLK+HVA+FGTWV VIRVTPYILH+ Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGTWVAVIRVTPYILHY 42 >ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|659118678|ref|XP_008459247.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] gi|659118680|ref|XP_008459248.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] gi|778669220|ref|XP_011649217.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|700206642|gb|KGN61761.1| hypothetical protein Csa_2G238770 [Cucumis sativus] Length = 54 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQL+SHVAMFG WV VIRVTPY+LH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHY 42 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 82.4 bits (202), Expect = 1e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK ALKQLKSHVAMFG WVVV+RVTPY+LH+ Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHY 42 >ref|XP_012568945.1| PREDICTED: uncharacterized protein LOC101499851 isoform X1 [Cicer arietinum] Length = 109 Score = 81.6 bits (200), Expect = 2e-13 Identities = 43/77 (55%), Positives = 49/77 (63%) Frame = -2 Query: 396 SHVSRNVHAEAR*GCGTEAAEISCRHVRDMGCCYXXXXXXXXXXXSRE*GTQARALDSHL 217 SHVSRNVHA+AR GC EAAEISC HV +MGCC+ RE GTQAR LDS++ Sbjct: 33 SHVSRNVHAKARQGCSIEAAEISCCHVWNMGCCHSSCALHPLLFQRRERGTQARNLDSYI 92 Query: 216 WLRGGGYVLGFKRNFIE 166 + GF RNFIE Sbjct: 93 VVLMTKCAFGFSRNFIE 109 >ref|XP_010096240.1| hypothetical protein L484_026977 [Morus notabilis] gi|587874497|gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQL++HVAMFG WV VIRVTPYILH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLRTHVAMFGAWVAVIRVTPYILHY 42 >ref|XP_012458102.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|823251026|ref|XP_012458103.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|763810991|gb|KJB77893.1| hypothetical protein B456_012G163900 [Gossypium raimondii] Length = 54 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLK HVAMFG WV V+RVTPYILH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHY 42 >gb|KHG18108.1| Mitochondrial import receptor subunit TOM6 -like protein [Gossypium arboreum] Length = 76 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLK HVAMFG WV V+RVTPYILH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHY 42 >ref|XP_007019163.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] gi|508724491|gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPGMFMRKPDK AALKQLK HVAMFG WV V+RVTPYILH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHY 42 >ref|XP_011092754.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Sesamum indicum] Length = 54 Score = 80.9 bits (198), Expect = 3e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPG+FMRKPDK AA+KQLKSHVAMFG WV V+RVTPY+LH+ Sbjct: 1 MFPGLFMRKPDKAAAIKQLKSHVAMFGVWVAVVRVTPYLLHY 42 >ref|XP_009596562.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] gi|698489778|ref|XP_009791420.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] Length = 54 Score = 80.5 bits (197), Expect = 5e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPG+FMRKPDK AALKQLK+HVA+FG WV VIRVTPYILH+ Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGAWVAVIRVTPYILHY 42 >ref|XP_009618631.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] Length = 54 Score = 80.5 bits (197), Expect = 5e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 392 MFPGMFMRKPDKGAALKQLKSHVAMFGTWVVVIRVTPYILHF 267 MFPG+FMRKPDK AALKQLK+HVA+FGTWV VIRV PYILH+ Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGTWVAVIRVAPYILHY 42