BLASTX nr result
ID: Wisteria21_contig00011392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00011392 (654 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007132650.1| hypothetical protein PHAVU_011G113100g [Phas... 60 1e-06 >ref|XP_007132650.1| hypothetical protein PHAVU_011G113100g [Phaseolus vulgaris] gi|561005650|gb|ESW04644.1| hypothetical protein PHAVU_011G113100g [Phaseolus vulgaris] Length = 51 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 505 MAKLEEMDESEAKIKKKRNHGSSRFFVFVDY 413 MAKLEEMD S AKIKKKRNHGS+RFFVFVDY Sbjct: 1 MAKLEEMDNSVAKIKKKRNHGSTRFFVFVDY 31