BLASTX nr result
ID: Wisteria21_contig00011187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00011187 (446 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007142073.1| hypothetical protein PHAVU_008G250300g [Phas... 59 1e-06 >ref|XP_007142073.1| hypothetical protein PHAVU_008G250300g [Phaseolus vulgaris] gi|561015206|gb|ESW14067.1| hypothetical protein PHAVU_008G250300g [Phaseolus vulgaris] Length = 53 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = -2 Query: 370 MKLFWFIQCFFCMVLLLINPSVXXXXXXXPSHGDIDSLVTSPPPPKKTHGSRP 212 MK FWF+QC FCM +LLI+PSV PS GD+ T P P+K GSRP Sbjct: 1 MKFFWFLQCLFCMAMLLISPSVAPNAPAPPSSGDLKVPETPPQLPRKVSGSRP 53