BLASTX nr result
ID: Wisteria21_contig00011071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00011071 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598177.1| phenylcoumaran benzylic ether reductase-like... 59 1e-06 ref|XP_004499621.1| PREDICTED: eugenol synthase 1-like isoform X... 58 2e-06 ref|XP_004499620.1| PREDICTED: eugenol synthase 1-like isoform X... 58 2e-06 gb|KRH62775.1| hypothetical protein GLYMA_04G131100 [Glycine max] 57 4e-06 gb|KRH56312.1| hypothetical protein GLYMA_06G317000 [Glycine max] 57 4e-06 gb|KHN37444.1| Eugenol synthase 1 [Glycine soja] 57 4e-06 ref|XP_003522882.1| PREDICTED: eugenol synthase 1-like isoform 1... 57 4e-06 ref|XP_003598162.1| phenylcoumaran benzylic ether reductase-like... 57 4e-06 gb|ACU18935.1| unknown [Glycine max] 57 4e-06 ref|XP_013458808.1| phenylcoumaran benzylic ether reductase-like... 57 7e-06 gb|AFK43365.1| unknown [Medicago truncatula] 57 7e-06 ref|XP_003598174.1| phenylcoumaran benzylic ether reductase-like... 57 7e-06 ref|XP_003598173.1| phenylcoumaran benzylic ether reductase-like... 57 7e-06 >ref|XP_003598177.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] gi|355487225|gb|AES68428.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] Length = 316 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 EL ENDLEASQLYP+YNY SIDQLLDKFLVD Sbjct: 276 ELEENDLEASQLYPNYNYTSIDQLLDKFLVD 306 >ref|XP_004499621.1| PREDICTED: eugenol synthase 1-like isoform X2 [Cicer arietinum] Length = 261 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 +LGE+DLE SQLYP+YNY SIDQLLDKFLVD Sbjct: 221 DLGEDDLEVSQLYPEYNYTSIDQLLDKFLVD 251 >ref|XP_004499620.1| PREDICTED: eugenol synthase 1-like isoform X1 [Cicer arietinum] Length = 317 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 +LGE+DLE SQLYP+YNY SIDQLLDKFLVD Sbjct: 277 DLGEDDLEVSQLYPEYNYTSIDQLLDKFLVD 307 >gb|KRH62775.1| hypothetical protein GLYMA_04G131100 [Glycine max] Length = 322 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 E+GE+DLEASQLYPDYNY SID+LLD FLVD Sbjct: 282 EIGEDDLEASQLYPDYNYTSIDELLDIFLVD 312 >gb|KRH56312.1| hypothetical protein GLYMA_06G317000 [Glycine max] Length = 287 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFL 339 ELGENDLEASQLYPDYNY SIDQLLD FL Sbjct: 235 ELGENDLEASQLYPDYNYTSIDQLLDIFL 263 >gb|KHN37444.1| Eugenol synthase 1 [Glycine soja] Length = 317 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 E+GE+DLEASQLYPDYNY SID+LLD FLVD Sbjct: 277 EIGEDDLEASQLYPDYNYTSIDELLDIFLVD 307 >ref|XP_003522882.1| PREDICTED: eugenol synthase 1-like isoform 1 [Glycine max] Length = 314 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 E+GE+DLEASQLYPDYNY SID+LLD FLVD Sbjct: 274 EIGEDDLEASQLYPDYNYTSIDELLDIFLVD 304 >ref|XP_003598162.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] gi|355487210|gb|AES68413.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] Length = 317 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 EL E+DLEASQLYP+YNY SIDQLLDKFLVD Sbjct: 277 ELEEDDLEASQLYPNYNYMSIDQLLDKFLVD 307 >gb|ACU18935.1| unknown [Glycine max] Length = 314 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 E+GE+DLEASQLYPDYNY SID+LLD FLVD Sbjct: 274 EIGEDDLEASQLYPDYNYTSIDELLDIFLVD 304 >ref|XP_013458808.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] gi|657391676|gb|KEH32840.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] Length = 249 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 EL E+DLEASQLYP YNY SIDQLLDKFLVD Sbjct: 209 ELEEDDLEASQLYPGYNYTSIDQLLDKFLVD 239 >gb|AFK43365.1| unknown [Medicago truncatula] Length = 317 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 EL E+DLEASQLYP YNY SIDQLLDKFLVD Sbjct: 277 ELEEDDLEASQLYPGYNYTSIDQLLDKFLVD 307 >ref|XP_003598174.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] gi|355487222|gb|AES68425.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] Length = 310 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 EL E+DLEASQLYP YNY SIDQLLDKFLVD Sbjct: 270 ELEEDDLEASQLYPGYNYTSIDQLLDKFLVD 300 >ref|XP_003598173.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] gi|355487221|gb|AES68424.1| phenylcoumaran benzylic ether reductase-like protein [Medicago truncatula] Length = 317 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 425 ELGENDLEASQLYPDYNYKSIDQLLDKFLVD 333 EL E+DLEASQLYP YNY SIDQLLDKFLVD Sbjct: 277 ELEEDDLEASQLYPGYNYTSIDQLLDKFLVD 307