BLASTX nr result
ID: Wisteria21_contig00010799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010799 (453 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601141.2| serine transhydroxymethyltransferase [Medica... 64 3e-08 >ref|XP_003601141.2| serine transhydroxymethyltransferase [Medicago truncatula] gi|657394187|gb|AES71392.2| serine transhydroxymethyltransferase [Medicago truncatula] Length = 577 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -1 Query: 138 MDAQTGLSLGLNGSVPSPTALSTAPLCDNSFSFQVNSISTPSLSWR 1 MDAQ GLSLGLN ++PSPT S L DNSFSF +NS PSLSWR Sbjct: 1 MDAQAGLSLGLNATMPSPTNSSNGSLTDNSFSFHLNSKPNPSLSWR 46