BLASTX nr result
ID: Wisteria21_contig00010645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010645 (467 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDX71772.1| BnaC08g31020D [Brassica napus] 72 1e-10 ref|XP_007134902.1| hypothetical protein PHAVU_010G085500g [Phas... 72 1e-10 ref|XP_004510938.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 72 2e-10 ref|XP_002279840.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 72 2e-10 pdb|3TUU|A Chain A, Structure Of Dihydrodipicolinate Synthase Fr... 72 2e-10 emb|CAK18842.1| dihydropicolinate synthase (DHDPS) precursor [Ph... 71 3e-10 ref|XP_010469136.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 71 4e-10 ref|XP_010469135.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 71 4e-10 ref|XP_010413505.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 71 4e-10 ref|XP_006402532.1| hypothetical protein EUTSA_v10006047mg [Eutr... 71 4e-10 ref|XP_006290360.1| hypothetical protein CARUB_v10017487mg [Caps... 71 4e-10 gb|AFK39505.1| unknown [Lotus japonicus] 71 4e-10 gb|AFK36298.1| unknown [Lotus japonicus] 71 4e-10 gb|KHG01651.1| Dihydrodipicolinate synthase 2, chloroplastic -li... 70 5e-10 ref|XP_013445008.1| 4-hydroxy-tetrahydrodipicolinate synthase [M... 70 5e-10 gb|KOM31642.1| hypothetical protein LR48_Vigan01g119700 [Vigna a... 70 6e-10 emb|CDY52342.1| BnaA09g38910D [Brassica napus] 70 6e-10 ref|XP_013602221.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 70 8e-10 ref|NP_182068.1| dihydrodipicolinate synthase [Arabidopsis thali... 70 8e-10 ref|NP_850730.1| dihydrodipicolinate synthase 1 [Arabidopsis tha... 70 8e-10 >emb|CDX71772.1| BnaC08g31020D [Brassica napus] Length = 362 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 PM KRVEFV LVKE+GREHFVGE+DV+VLDD DFI++GRY Sbjct: 323 PMSKRVEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 362 >ref|XP_007134902.1| hypothetical protein PHAVU_010G085500g [Phaseolus vulgaris] gi|561007947|gb|ESW06896.1| hypothetical protein PHAVU_010G085500g [Phaseolus vulgaris] Length = 369 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -2 Query: 463 MEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 ++KRVEFVNLVK+MGREHFVGEKD +VLDD DFIIVGRY Sbjct: 331 VDKRVEFVNLVKQMGREHFVGEKDAQVLDDDDFIIVGRY 369 >ref|XP_004510938.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic-like [Cicer arietinum] Length = 358 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -2 Query: 463 MEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 ME+RVEFVNLVKE+GREHFVG+KDVRVL+D +FIIVGRY Sbjct: 320 MEQRVEFVNLVKEIGREHFVGDKDVRVLEDDEFIIVGRY 358 >ref|XP_002279840.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic [Vitis vinifera] gi|296089164|emb|CBI38867.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KRVEFVN+VKE+GRE+FVGEKDV+VLDD DFI+VGRY Sbjct: 326 PLAKRVEFVNIVKEIGRENFVGEKDVKVLDDDDFILVGRY 365 >pdb|3TUU|A Chain A, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261064|pdb|3TUU|B Chain B, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261065|pdb|3TUU|C Chain C, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261066|pdb|3TUU|D Chain D, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261067|pdb|3TUU|E Chain E, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261068|pdb|3TUU|F Chain F, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261069|pdb|3TUU|G Chain G, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|400261070|pdb|3TUU|H Chain H, Structure Of Dihydrodipicolinate Synthase From The Common Grapevine gi|538261131|pdb|4HNN|A Chain A, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261132|pdb|4HNN|B Chain B, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261133|pdb|4HNN|C Chain C, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261134|pdb|4HNN|D Chain D, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261135|pdb|4HNN|E Chain E, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261136|pdb|4HNN|F Chain F, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261137|pdb|4HNN|G Chain G, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine gi|538261138|pdb|4HNN|H Chain H, Dihydrodipicolinate Synthase From The Common Grapevine With Pyruvate And Lysine Length = 346 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KRVEFVN+VKE+GRE+FVGEKDV+VLDD DFI+VGRY Sbjct: 307 PLAKRVEFVNIVKEIGRENFVGEKDVKVLDDDDFILVGRY 346 >emb|CAK18842.1| dihydropicolinate synthase (DHDPS) precursor [Phillyrea latifolia] Length = 78 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KRVEFVN+VKE+GRE+FVGEKDV+VLDD DFI++GRY Sbjct: 39 PLAKRVEFVNIVKELGRENFVGEKDVQVLDDDDFILIGRY 78 >ref|XP_010469136.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic-like isoform X2 [Camelina sativa] Length = 365 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KR+EFV LVKE+GREHFVGE+DV+VLDD DFI++GRY Sbjct: 326 PLSKRIEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 365 >ref|XP_010469135.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic-like isoform X1 [Camelina sativa] Length = 364 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KR+EFV LVKE+GREHFVGE+DV+VLDD DFI++GRY Sbjct: 325 PLSKRIEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 364 >ref|XP_010413505.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic-like [Camelina sativa] Length = 364 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KR+EFV LVKE+GREHFVGE+DV+VLDD DFI++GRY Sbjct: 325 PLSKRIEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 364 >ref|XP_006402532.1| hypothetical protein EUTSA_v10006047mg [Eutrema salsugineum] gi|557103631|gb|ESQ43985.1| hypothetical protein EUTSA_v10006047mg [Eutrema salsugineum] Length = 365 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KRVEFV LVKE+GREHFVGE+DV+VLDD DFI++GRY Sbjct: 326 PVSKRVEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 365 >ref|XP_006290360.1| hypothetical protein CARUB_v10017487mg [Capsella rubella] gi|482559067|gb|EOA23258.1| hypothetical protein CARUB_v10017487mg [Capsella rubella] Length = 365 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KR+EFV LVKE+GREHFVGE+DV+VLDD DFI++GRY Sbjct: 326 PLSKRIEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 365 >gb|AFK39505.1| unknown [Lotus japonicus] Length = 90 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+EKR+EFVNLVKE+GREHFVG+KDV+VLD+ DFI+V RY Sbjct: 51 PVEKRIEFVNLVKEIGREHFVGDKDVQVLDNDDFILVSRY 90 >gb|AFK36298.1| unknown [Lotus japonicus] Length = 306 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+EKR+EFVNLVKE+GREHFVG+KDV+VLD+ DFI+V RY Sbjct: 267 PVEKRIEFVNLVKEIGREHFVGDKDVQVLDNDDFILVSRY 306 >gb|KHG01651.1| Dihydrodipicolinate synthase 2, chloroplastic -like protein [Gossypium arboreum] Length = 365 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+EKRVEFVNLVKE+GRE+FVG+ D++VLDD DFI+VGRY Sbjct: 326 PLEKRVEFVNLVKEIGRENFVGKNDIQVLDDDDFILVGRY 365 >ref|XP_013445008.1| 4-hydroxy-tetrahydrodipicolinate synthase [Medicago truncatula] gi|657373295|gb|KEH19033.1| 4-hydroxy-tetrahydrodipicolinate synthase [Medicago truncatula] Length = 358 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+E+R EFVNLVKE+GREHFVGEKDV+VLDD DFI+V RY Sbjct: 319 PVEQRREFVNLVKEIGREHFVGEKDVQVLDDDDFIVVARY 358 >gb|KOM31642.1| hypothetical protein LR48_Vigan01g119700 [Vigna angularis] Length = 400 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KR+EFVNLVK+MGREHFVGEKD +VL++ DFI+VGRY Sbjct: 361 PVNKRIEFVNLVKQMGREHFVGEKDAQVLENDDFIVVGRY 400 >emb|CDY52342.1| BnaA09g38910D [Brassica napus] Length = 268 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 PM RVEFV LVKE+GREHFVGE+DV+VLDD DFI++GRY Sbjct: 229 PMSTRVEFVKLVKEIGREHFVGERDVQVLDDDDFILIGRY 268 >ref|XP_013602221.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic-like [Brassica oleracea var. oleracea] Length = 362 Score = 69.7 bits (169), Expect = 8e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 PM KRVEFV LVKE+GREHFVG +DV+VLDD DFI++GRY Sbjct: 323 PMSKRVEFVKLVKEIGREHFVGGRDVQVLDDDDFILIGRY 362 >ref|NP_182068.1| dihydrodipicolinate synthase [Arabidopsis thaliana] gi|14547964|sp|Q9FVC8.2|DAPA2_ARATH RecName: Full=4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic; Short=HTPA synthase 2; Flags: Precursor gi|2583111|gb|AAB82620.1| putative dihydrodipicolinate synthase [Arabidopsis thaliana] gi|28466961|gb|AAO44089.1| At2g45440 [Arabidopsis thaliana] gi|110735769|dbj|BAE99862.1| putative dihydrodipicolinate synthase [Arabidopsis thaliana] gi|330255460|gb|AEC10554.1| dihydrodipicolinate synthase [Arabidopsis thaliana] Length = 365 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KR+EFV LVKE+GREHFVGEKDV+ LDD DFI++GRY Sbjct: 326 PLSKRLEFVKLVKEIGREHFVGEKDVQALDDDDFILIGRY 365 >ref|NP_850730.1| dihydrodipicolinate synthase 1 [Arabidopsis thaliana] gi|38503407|sp|Q9LZX6.2|DAPA1_ARATH RecName: Full=4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic; Short=HTPA synthase 1; Flags: Precursor gi|17380974|gb|AAL36299.1| putative dihydrodipicolinate synthase precursor [Arabidopsis thaliana] gi|20465357|gb|AAM20082.1| putative dihydrodipicolinate synthase precursor [Arabidopsis thaliana] gi|332646600|gb|AEE80121.1| dihydrodipicolinate synthase 1 [Arabidopsis thaliana] Length = 365 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -2 Query: 466 PMEKRVEFVNLVKEMGREHFVGEKDVRVLDDHDFIIVGRY 347 P+ KR+EFV LVKE+GREHFVG++DV+VLDD DFI++GRY Sbjct: 326 PLSKRIEFVKLVKEIGREHFVGDRDVQVLDDDDFILIGRY 365