BLASTX nr result
ID: Wisteria21_contig00010598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010598 (286 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH21796.1| hypothetical protein GLYMA_13G259300 [Glycine max] 71 3e-10 gb|KHN47478.1| Coiled-coil domain-containing protein 94 like [Gl... 71 3e-10 ref|XP_006594687.1| PREDICTED: coiled-coil domain-containing pro... 71 3e-10 gb|KRH13581.1| hypothetical protein GLYMA_15G248800 [Glycine max] 66 1e-08 gb|KRH13580.1| hypothetical protein GLYMA_15G248800 [Glycine max] 66 1e-08 gb|KHN29851.1| Coiled-coil domain-containing protein 94 like [Gl... 66 1e-08 ref|NP_001276289.1| coiled-coil domain-containing protein 94 hom... 64 3e-08 ref|XP_004488650.1| PREDICTED: coiled-coil domain-containing pro... 59 2e-06 >gb|KRH21796.1| hypothetical protein GLYMA_13G259300 [Glycine max] Length = 322 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -3 Query: 284 VTSDVESPADPDQKKKEEDIKTNSTSGLLSLCQNYGSDE 168 VTSDV+SPA+P+QKK+EED KTN+TSGLLSLCQNYGSD+ Sbjct: 282 VTSDVKSPAEPEQKKEEEDSKTNTTSGLLSLCQNYGSDD 320 >gb|KHN47478.1| Coiled-coil domain-containing protein 94 like [Glycine soja] Length = 272 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -3 Query: 284 VTSDVESPADPDQKKKEEDIKTNSTSGLLSLCQNYGSDE 168 VTSDV+SPA+P+QKK+EED KTN+TSGLLSLCQNYGSD+ Sbjct: 232 VTSDVKSPAEPEQKKEEEDSKTNTTSGLLSLCQNYGSDD 270 >ref|XP_006594687.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Glycine max] Length = 326 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -3 Query: 284 VTSDVESPADPDQKKKEEDIKTNSTSGLLSLCQNYGSDE 168 VTSDV+SPA+P+QKK+EED KTN+TSGLLSLCQNYGSD+ Sbjct: 286 VTSDVKSPAEPEQKKEEEDSKTNTTSGLLSLCQNYGSDD 324 >gb|KRH13581.1| hypothetical protein GLYMA_15G248800 [Glycine max] Length = 323 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -3 Query: 284 VTSDVESPADPDQKKKEEDIKTNSTSGLLSLCQNYGSDE 168 VTSDV+SPA+P+QKK+E+D +TN+ SGLLSLCQNYGSD+ Sbjct: 283 VTSDVKSPAEPEQKKQEKDNETNTASGLLSLCQNYGSDD 321 >gb|KRH13580.1| hypothetical protein GLYMA_15G248800 [Glycine max] Length = 326 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -3 Query: 284 VTSDVESPADPDQKKKEEDIKTNSTSGLLSLCQNYGSDE 168 VTSDV+SPA+P+QKK+E+D +TN+ SGLLSLCQNYGSD+ Sbjct: 286 VTSDVKSPAEPEQKKQEKDNETNTASGLLSLCQNYGSDD 324 >gb|KHN29851.1| Coiled-coil domain-containing protein 94 like [Glycine soja] Length = 272 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -3 Query: 284 VTSDVESPADPDQKKKEEDIKTNSTSGLLSLCQNYGSDE 168 VTSDV+SPA+P+QKK+E+D +TN+ SGLLSLCQNYGSD+ Sbjct: 232 VTSDVKSPAEPEQKKQEKDNETNTASGLLSLCQNYGSDD 270 >ref|NP_001276289.1| coiled-coil domain-containing protein 94 homolog [Glycine max] gi|255642439|gb|ACU21483.1| unknown [Glycine max] Length = 326 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -3 Query: 284 VTSDVESPADPDQKKKEEDIKTNSTSGLLSLCQNYGSDE 168 VTSD +SPA+P+QKK+E+D +TN+ SGLLSLCQNYGSD+ Sbjct: 286 VTSDAKSPAEPEQKKQEKDNETNTASGLLSLCQNYGSDD 324 >ref|XP_004488650.1| PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] gi|502087813|ref|XP_004488651.1| PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] gi|828292091|ref|XP_012567716.1| PREDICTED: coiled-coil domain-containing protein 94 [Cicer arietinum] Length = 330 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -3 Query: 281 TSDVESPADPDQKKKEEDIKTNSTSGLLSLCQNYGSDE 168 TS+++SPA+P QK+KEED KTN+T LLSLCQ+YGS+E Sbjct: 290 TSNIKSPAEPKQKEKEEDNKTNTTGVLLSLCQSYGSEE 327