BLASTX nr result
ID: Wisteria21_contig00010504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00010504 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014503138.1| PREDICTED: uncharacterized protein LOC106763... 63 8e-08 gb|KOM55592.1| hypothetical protein LR48_Vigan10g148400 [Vigna a... 56 9e-06 ref|XP_002325841.1| hypothetical protein POPTR_0019s05120g [Popu... 56 9e-06 ref|XP_007151850.1| hypothetical protein PHAVU_004G080700g [Phas... 56 9e-06 >ref|XP_014503138.1| PREDICTED: uncharacterized protein LOC106763459 [Vigna radiata var. radiata] Length = 277 Score = 63.2 bits (152), Expect = 8e-08 Identities = 40/65 (61%), Positives = 44/65 (67%), Gaps = 8/65 (12%) Frame = -1 Query: 173 MDLDEWEFLSDDG-----KDGEK---KALPGKVNLGSESVFDMDYCYPSSPPRKPRVVHN 18 MD+DEWEFLSDDG +DGEK K GK L S+SVFDMDY + SSPP PR V Sbjct: 1 MDIDEWEFLSDDGYLDFNEDGEKQKQKNSLGKGKLDSKSVFDMDY-FCSSPPPPPR-VRT 58 Query: 17 QLVPL 3 QLVPL Sbjct: 59 QLVPL 63 >gb|KOM55592.1| hypothetical protein LR48_Vigan10g148400 [Vigna angularis] Length = 277 Score = 56.2 bits (134), Expect = 9e-06 Identities = 37/65 (56%), Positives = 42/65 (64%), Gaps = 8/65 (12%) Frame = -1 Query: 173 MDLDEWEFLSDDG-----KDGEK---KALPGKVNLGSESVFDMDYCYPSSPPRKPRVVHN 18 MD+DEWEFLSDDG +DG K K GK L S+SVFDMDY + SSPP P V Sbjct: 1 MDIDEWEFLSDDGYLDFNEDGGKQKQKNSLGKGKLDSKSVFDMDY-FCSSPP--PPRVRT 57 Query: 17 QLVPL 3 Q+VPL Sbjct: 58 QVVPL 62 >ref|XP_002325841.1| hypothetical protein POPTR_0019s05120g [Populus trichocarpa] gi|566232000|ref|XP_006371164.1| hypothetical protein POPTR_0019s05120g [Populus trichocarpa] gi|222862716|gb|EEF00223.1| hypothetical protein POPTR_0019s05120g [Populus trichocarpa] gi|550316825|gb|ERP48961.1| hypothetical protein POPTR_0019s05120g [Populus trichocarpa] Length = 299 Score = 56.2 bits (134), Expect = 9e-06 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 9/66 (13%) Frame = -1 Query: 173 MDLDEWEFLSDDG-----KDGEKKALPGKVNLGS---ESVFDMDYCY-PSSPPRKPRVVH 21 MDL+EWE L DG +DGEKK GS +++FDM+Y PSSPP+ RVV Sbjct: 1 MDLEEWELLPHDGFIDYHEDGEKKTFGASKRSGSPNPKAMFDMNYFMCPSSPPKHSRVVP 60 Query: 20 NQLVPL 3 NQLVP+ Sbjct: 61 NQLVPV 66 >ref|XP_007151850.1| hypothetical protein PHAVU_004G080700g [Phaseolus vulgaris] gi|561025159|gb|ESW23844.1| hypothetical protein PHAVU_004G080700g [Phaseolus vulgaris] Length = 275 Score = 56.2 bits (134), Expect = 9e-06 Identities = 35/66 (53%), Positives = 40/66 (60%), Gaps = 9/66 (13%) Frame = -1 Query: 173 MDLDEWEFLSDD---------GKDGEKKALPGKVNLGSESVFDMDYCYPSSPPRKPRVVH 21 MD+DEWEFLSD+ GK +K +L GK L S+SVFDMDY S PPR V Sbjct: 1 MDIDEWEFLSDEVYLDFNEDGGKQKQKNSL-GKGKLDSKSVFDMDYFCSSPPPR----VS 55 Query: 20 NQLVPL 3 QLVPL Sbjct: 56 TQLVPL 61