BLASTX nr result
ID: Wisteria21_contig00009947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009947 (382 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN34653.1| Cationic amino acid transporter 2, vacuolar [Glyc... 74 3e-11 ref|XP_006604261.1| PREDICTED: cationic amino acid transporter 2... 74 3e-11 ref|XP_007161868.1| hypothetical protein PHAVU_001G104700g [Phas... 72 1e-10 gb|KOM38598.1| hypothetical protein LR48_Vigan03g198000 [Vigna a... 71 3e-10 ref|XP_014491175.1| PREDICTED: cationic amino acid transporter 2... 70 8e-10 ref|XP_003624709.1| cationic amino acid transporter 2, vacuolar ... 68 2e-09 ref|XP_010097426.1| Cationic amino acid transporter 2 [Morus not... 64 4e-08 gb|KDO66060.1| hypothetical protein CISIN_1g006102mg [Citrus sin... 64 4e-08 gb|KDO66059.1| hypothetical protein CISIN_1g006102mg [Citrus sin... 64 4e-08 ref|XP_006443501.1| hypothetical protein CICLE_v10019203mg [Citr... 64 4e-08 ref|XP_008244218.1| PREDICTED: cationic amino acid transporter 2... 64 6e-08 ref|XP_007204606.1| hypothetical protein PRUPE_ppa002665mg [Prun... 63 7e-08 ref|XP_003525716.1| PREDICTED: cationic amino acid transporter 2... 63 7e-08 ref|XP_008791390.1| PREDICTED: cationic amino acid transporter 3... 62 1e-07 ref|XP_006651645.1| PREDICTED: cationic amino acid transporter 2... 62 1e-07 ref|XP_002464148.1| hypothetical protein SORBIDRAFT_01g013100 [S... 62 1e-07 ref|XP_009398514.1| PREDICTED: cationic amino acid transporter 2... 62 2e-07 ref|XP_009343029.1| PREDICTED: cationic amino acid transporter 2... 62 2e-07 ref|XP_009343028.1| PREDICTED: cationic amino acid transporter 2... 62 2e-07 ref|XP_009366507.1| PREDICTED: cationic amino acid transporter 2... 62 2e-07 >gb|KHN34653.1| Cationic amino acid transporter 2, vacuolar [Glycine soja] Length = 634 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WLA GLLVYVFYGRTHSSLKDAIYVPA+QVD IYQ RS +A Sbjct: 592 IWLATGLLVYVFYGRTHSSLKDAIYVPAKQVDEIYQNYRSCLA 634 >ref|XP_006604261.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Glycine max] gi|947045270|gb|KRG94899.1| hypothetical protein GLYMA_19G116500 [Glycine max] Length = 634 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WLA GLLVYVFYGRTHSSLKDAIYVPA+QVD IYQ RS +A Sbjct: 592 IWLATGLLVYVFYGRTHSSLKDAIYVPAKQVDEIYQNYRSCLA 634 >ref|XP_007161868.1| hypothetical protein PHAVU_001G104700g [Phaseolus vulgaris] gi|561035332|gb|ESW33862.1| hypothetical protein PHAVU_001G104700g [Phaseolus vulgaris] Length = 586 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WL GLLVYVFYGRTHS LKDAIYVPA+QVD IYQT RS V+ Sbjct: 544 IWLGTGLLVYVFYGRTHSFLKDAIYVPAKQVDEIYQTYRSSVS 586 >gb|KOM38598.1| hypothetical protein LR48_Vigan03g198000 [Vigna angularis] Length = 632 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +W+ GLLVYVFYGRTHS LKDAIYVPA+QVD IYQT RS A Sbjct: 590 IWMGTGLLVYVFYGRTHSFLKDAIYVPAKQVDEIYQTYRSSAA 632 >ref|XP_014491175.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Vigna radiata var. radiata] Length = 632 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRS 262 +W+ GLLVYVFYGRTHS LKDAIYVPA QVD IYQT RS Sbjct: 590 IWMGTGLLVYVFYGRTHSFLKDAIYVPAEQVDEIYQTYRS 629 >ref|XP_003624709.1| cationic amino acid transporter 2, vacuolar protein [Medicago truncatula] gi|355499724|gb|AES80927.1| cationic amino acid transporter 2, vacuolar protein [Medicago truncatula] Length = 618 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 VWLA GLL+Y FYGRTHSSLKDAIYVPA QVD YQ RS+ A Sbjct: 576 VWLATGLLIYGFYGRTHSSLKDAIYVPASQVDERYQPPRSHAA 618 >ref|XP_010097426.1| Cationic amino acid transporter 2 [Morus notabilis] gi|587879061|gb|EXB68043.1| Cationic amino acid transporter 2 [Morus notabilis] Length = 642 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 VWL IG VY FYGRTHSSL+DA+YVP + D IY++ SYVA Sbjct: 600 VWLVIGACVYAFYGRTHSSLRDAVYVPVARADEIYRSSASYVA 642 >gb|KDO66060.1| hypothetical protein CISIN_1g006102mg [Citrus sinensis] Length = 505 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCR 265 VWL IG+LVYVFYGRTHSSL DA+YVPA VD IY++ R Sbjct: 446 VWLIIGVLVYVFYGRTHSSLLDAVYVPAAHVDEIYRSSR 484 >gb|KDO66059.1| hypothetical protein CISIN_1g006102mg [Citrus sinensis] Length = 661 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCR 265 VWL IG+LVYVFYGRTHSSL DA+YVPA VD IY++ R Sbjct: 602 VWLIIGVLVYVFYGRTHSSLLDAVYVPAAHVDEIYRSSR 640 >ref|XP_006443501.1| hypothetical protein CICLE_v10019203mg [Citrus clementina] gi|568850985|ref|XP_006479175.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Citrus sinensis] gi|557545763|gb|ESR56741.1| hypothetical protein CICLE_v10019203mg [Citrus clementina] Length = 661 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCR 265 VWL IG+LVYVFYGRTHSSL DA+YVPA VD IY++ R Sbjct: 602 VWLIIGVLVYVFYGRTHSSLLDAVYVPAAHVDEIYRSSR 640 >ref|XP_008244218.1| PREDICTED: cationic amino acid transporter 2, vacuolar [Prunus mume] Length = 630 Score = 63.5 bits (153), Expect = 6e-08 Identities = 25/43 (58%), Positives = 37/43 (86%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WL +G+++YVFYGRTHSSL+DAIYVPA + D I+++ +YV+ Sbjct: 588 IWLLVGVVIYVFYGRTHSSLEDAIYVPAARADEIFRSSENYVS 630 >ref|XP_007204606.1| hypothetical protein PRUPE_ppa002665mg [Prunus persica] gi|462400137|gb|EMJ05805.1| hypothetical protein PRUPE_ppa002665mg [Prunus persica] Length = 647 Score = 63.2 bits (152), Expect = 7e-08 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WL +G+++YVFYGRTHSSL+DAIYVPA D I+++ +YV+ Sbjct: 605 IWLLVGVVIYVFYGRTHSSLEDAIYVPAAHADEIFRSSENYVS 647 >ref|XP_003525716.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Glycine max] gi|734366678|gb|KHN18136.1| Cationic amino acid transporter 2, vacuolar [Glycine soja] gi|947109541|gb|KRH57867.1| hypothetical protein GLYMA_05G089200 [Glycine max] Length = 640 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WLAIG++VYVFYGRTHS+LKDA+ VPA QV IY T S +A Sbjct: 598 IWLAIGVIVYVFYGRTHSTLKDAVCVPATQVVDIYHTSTSCLA 640 >ref|XP_008791390.1| PREDICTED: cationic amino acid transporter 3, mitochondrial-like isoform X1 [Phoenix dactylifera] Length = 640 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WL IG+ VY+FYGRTHSSL DA+YVP D IY+T YVA Sbjct: 598 IWLMIGVFVYLFYGRTHSSLTDAVYVPVAHADEIYRTSVEYVA 640 >ref|XP_006651645.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Oryza brachyantha] Length = 635 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WL IG+LVY+FYGRTHSSL++ +YVP Q D IY++ YV+ Sbjct: 593 IWLLIGVLVYIFYGRTHSSLRNVVYVPVAQADEIYRSSSGYVS 635 >ref|XP_002464148.1| hypothetical protein SORBIDRAFT_01g013100 [Sorghum bicolor] gi|241918002|gb|EER91146.1| hypothetical protein SORBIDRAFT_01g013100 [Sorghum bicolor] Length = 635 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WL +G+LVYVFYGRTHSSL D +YVP Q D IY++ YV+ Sbjct: 593 IWLLMGVLVYVFYGRTHSSLTDVVYVPVAQADEIYRSSSGYVS 635 >ref|XP_009398514.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Musa acuminata subsp. malaccensis] Length = 636 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 +WL IG+LVY+FYGRTHSSL D +YVPA + IY+T YVA Sbjct: 594 MWLLIGVLVYLFYGRTHSSLTDVVYVPAAHAEEIYRTSPDYVA 636 >ref|XP_009343029.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X2 [Pyrus x bretschneideri] Length = 643 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 VWL IG++VYVFYGR+HSSL+DA+YVP D I+++ +YVA Sbjct: 601 VWLLIGVVVYVFYGRSHSSLEDAVYVPVAHADEIFRSSETYVA 643 >ref|XP_009343028.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like isoform X1 [Pyrus x bretschneideri] Length = 651 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 VWL IG++VYVFYGR+HSSL+DA+YVP D I+++ +YVA Sbjct: 609 VWLLIGVVVYVFYGRSHSSLEDAVYVPVAHADEIFRSSETYVA 651 >ref|XP_009366507.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Pyrus x bretschneideri] gi|694380802|ref|XP_009366509.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Pyrus x bretschneideri] Length = 643 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -2 Query: 381 VWLAIGLLVYVFYGRTHSSLKDAIYVPARQVDGIYQTCRSYVA 253 VWL IG++VYVFYGR+HSSL+DA+YVP D I+++ +YVA Sbjct: 601 VWLLIGVVVYVFYGRSHSSLEDAVYVPVAHADEIFRSSETYVA 643