BLASTX nr result
ID: Wisteria21_contig00009775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009775 (518 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH44212.1| hypothetical protein GLYMA_08G196700 [Glycine max] 58 3e-06 gb|KRH44211.1| hypothetical protein GLYMA_08G196700 [Glycine max] 58 3e-06 gb|KRH44208.1| hypothetical protein GLYMA_08G196700 [Glycine max] 58 3e-06 ref|XP_006585541.1| PREDICTED: anoctamin-like protein At1g73020-... 58 3e-06 ref|XP_006585539.1| PREDICTED: anoctamin-like protein At1g73020-... 58 3e-06 >gb|KRH44212.1| hypothetical protein GLYMA_08G196700 [Glycine max] Length = 531 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 93 MNEHGNEEPTFEIGVVIPSRVVQEKDEPSDC 1 M EHGNEEP FEIGVVIP RVVQEKDE DC Sbjct: 1 MKEHGNEEPVFEIGVVIPRRVVQEKDESCDC 31 >gb|KRH44211.1| hypothetical protein GLYMA_08G196700 [Glycine max] Length = 469 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 93 MNEHGNEEPTFEIGVVIPSRVVQEKDEPSDC 1 M EHGNEEP FEIGVVIP RVVQEKDE DC Sbjct: 1 MKEHGNEEPVFEIGVVIPRRVVQEKDESCDC 31 >gb|KRH44208.1| hypothetical protein GLYMA_08G196700 [Glycine max] Length = 596 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 93 MNEHGNEEPTFEIGVVIPSRVVQEKDEPSDC 1 M EHGNEEP FEIGVVIP RVVQEKDE DC Sbjct: 1 MKEHGNEEPVFEIGVVIPRRVVQEKDESCDC 31 >ref|XP_006585541.1| PREDICTED: anoctamin-like protein At1g73020-like isoform X3 [Glycine max] gi|571472237|ref|XP_006585542.1| PREDICTED: anoctamin-like protein At1g73020-like isoform X4 [Glycine max] Length = 552 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 93 MNEHGNEEPTFEIGVVIPSRVVQEKDEPSDC 1 M EHGNEEP FEIGVVIP RVVQEKDE DC Sbjct: 1 MKEHGNEEPVFEIGVVIPRRVVQEKDESCDC 31 >ref|XP_006585539.1| PREDICTED: anoctamin-like protein At1g73020-like isoform X1 [Glycine max] gi|947095624|gb|KRH44209.1| hypothetical protein GLYMA_08G196700 [Glycine max] Length = 658 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 93 MNEHGNEEPTFEIGVVIPSRVVQEKDEPSDC 1 M EHGNEEP FEIGVVIP RVVQEKDE DC Sbjct: 1 MKEHGNEEPVFEIGVVIPRRVVQEKDESCDC 31