BLASTX nr result
ID: Wisteria21_contig00009641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009641 (312 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014495326.1| PREDICTED: ribosomal protein S19, mitochondr... 61 4e-07 gb|KOM29913.1| hypothetical protein LR48_Vigan831s003100 [Vigna ... 61 4e-07 gb|KHN12364.1| Ribosomal protein S19, mitochondrial [Glycine soja] 60 6e-07 ref|XP_003531210.1| PREDICTED: ribosomal protein S19, mitochondr... 60 6e-07 ref|XP_003616878.2| ribosomal protein S19 [Medicago truncatula] ... 59 1e-06 ref|XP_007162637.1| hypothetical protein PHAVU_001G167500g [Phas... 56 9e-06 >ref|XP_014495326.1| PREDICTED: ribosomal protein S19, mitochondrial-like [Vigna radiata var. radiata] Length = 126 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/38 (78%), Positives = 30/38 (78%) Frame = -2 Query: 116 MRPTAMLRVLNKQFLGIAGDTANVVAKKLPPSPPVSRK 3 MRPT MLRVLNKQFLGI GD A VAKK PP P VSRK Sbjct: 1 MRPTLMLRVLNKQFLGIVGDAATAVAKKPPPPPVVSRK 38 >gb|KOM29913.1| hypothetical protein LR48_Vigan831s003100 [Vigna angularis] Length = 126 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/38 (78%), Positives = 30/38 (78%) Frame = -2 Query: 116 MRPTAMLRVLNKQFLGIAGDTANVVAKKLPPSPPVSRK 3 MRPT MLRVLNKQFLGI GD A VAKK PP P VSRK Sbjct: 1 MRPTMMLRVLNKQFLGIVGDAATAVAKKPPPPPVVSRK 38 >gb|KHN12364.1| Ribosomal protein S19, mitochondrial [Glycine soja] Length = 127 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/39 (79%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -2 Query: 116 MRPTAMLRVLNKQFLGIAGDTANVVAKKLPPSPP-VSRK 3 MRPT MLR L KQFLGI GDTAN VAKK PP PP VSRK Sbjct: 1 MRPTMMLRALTKQFLGIVGDTANTVAKKPPPPPPLVSRK 39 >ref|XP_003531210.1| PREDICTED: ribosomal protein S19, mitochondrial-like [Glycine max] gi|947094129|gb|KRH42714.1| hypothetical protein GLYMA_08G106800 [Glycine max] Length = 127 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/39 (79%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -2 Query: 116 MRPTAMLRVLNKQFLGIAGDTANVVAKKLPPSPP-VSRK 3 MRPT MLR L KQFLGI GDTAN VAKK PP PP VSRK Sbjct: 1 MRPTMMLRALTKQFLGIVGDTANTVAKKPPPPPPLVSRK 39 >ref|XP_003616878.2| ribosomal protein S19 [Medicago truncatula] gi|657385677|gb|AES99836.2| ribosomal protein S19 [Medicago truncatula] Length = 126 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 116 MRPTAMLRVLNKQFLGIAGDTANVVAKKLPPSPPV 12 MRPT MLRVLNKQF+GIAGDT N VAKKL SPP+ Sbjct: 1 MRPTYMLRVLNKQFIGIAGDTVNAVAKKLTSSPPL 35 >ref|XP_007162637.1| hypothetical protein PHAVU_001G167500g [Phaseolus vulgaris] gi|561036101|gb|ESW34631.1| hypothetical protein PHAVU_001G167500g [Phaseolus vulgaris] Length = 125 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = -2 Query: 116 MRPTAMLRVLNKQFLGIAGDTANVVAKKLPPSPPVSRK 3 MRPT ML+VLNKQFLGI GD A VAKK PP VSRK Sbjct: 1 MRPTMMLKVLNKQFLGIVGDAATAVAKKPPPPTIVSRK 38