BLASTX nr result
ID: Wisteria21_contig00009556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009556 (286 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536775.1| PREDICTED: COBW domain-containing protein 1 ... 63 1e-07 ref|XP_010063529.1| PREDICTED: COBW domain-containing protein 1 ... 61 3e-07 ref|XP_002268800.2| PREDICTED: COBW domain-containing protein 1 ... 61 3e-07 gb|KRG92963.1| hypothetical protein GLYMA_20G240400 [Glycine max] 61 4e-07 gb|KHN20283.1| COBW domain-containing protein 2 [Glycine soja] 61 4e-07 ref|XP_003556540.1| PREDICTED: COBW domain-containing protein 1-... 61 4e-07 ref|XP_008454190.1| PREDICTED: COBW domain-containing protein 1 ... 60 6e-07 ref|XP_004152183.1| PREDICTED: COBW domain-containing protein 1 ... 60 6e-07 gb|KOM36529.1| hypothetical protein LR48_Vigan02g267900 [Vigna a... 60 8e-07 ref|XP_007142702.1| hypothetical protein PHAVU_007G009700g [Phas... 60 8e-07 ref|XP_002517699.1| prli-interacting factor l, putative [Ricinus... 59 1e-06 gb|KNA17661.1| hypothetical protein SOVF_077890 [Spinacia oleracea] 59 1e-06 ref|XP_010097171.1| hypothetical protein L484_025717 [Morus nota... 59 1e-06 ref|XP_007023311.1| Plastid transcriptionally active 17 isoform ... 59 1e-06 ref|XP_011073380.1| PREDICTED: COBW domain-containing protein 1 ... 59 2e-06 ref|XP_011044876.1| PREDICTED: COBW domain-containing protein 1 ... 59 2e-06 ref|XP_011044875.1| PREDICTED: COBW domain-containing protein 1 ... 59 2e-06 ref|XP_012073113.1| PREDICTED: COBW domain-containing protein 1 ... 59 2e-06 ref|XP_006341395.1| PREDICTED: COBW domain-containing protein 1-... 59 2e-06 ref|XP_004235904.1| PREDICTED: COBW domain-containing protein 1 ... 59 2e-06 >ref|XP_003536775.1| PREDICTED: COBW domain-containing protein 1 isoform 1 [Glycine max] gi|734414487|gb|KHN37318.1| COBW domain-containing protein 1 [Glycine soja] gi|947087492|gb|KRH36213.1| hypothetical protein GLYMA_10G291200 [Glycine max] Length = 446 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPR+NKIVFIGKNLDAKELE+GFKACLL Sbjct: 417 PDEPRVNKIVFIGKNLDAKELEKGFKACLL 446 >ref|XP_010063529.1| PREDICTED: COBW domain-containing protein 1 [Eucalyptus grandis] gi|629105284|gb|KCW70753.1| hypothetical protein EUGRSUZ_F03922 [Eucalyptus grandis] Length = 452 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPR+NKIVFIGKNLDA+ELE+GFKACLL Sbjct: 423 PDEPRVNKIVFIGKNLDAQELEKGFKACLL 452 >ref|XP_002268800.2| PREDICTED: COBW domain-containing protein 1 [Vitis vinifera] gi|297743555|emb|CBI36422.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPR+NKIVFIGKNLD KELE+GFKACLL Sbjct: 424 PDEPRVNKIVFIGKNLDGKELEKGFKACLL 453 >gb|KRG92963.1| hypothetical protein GLYMA_20G240400 [Glycine max] Length = 466 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPRINKIVFIGK LDAKELE+GFKACLL Sbjct: 437 PDEPRINKIVFIGKKLDAKELEKGFKACLL 466 >gb|KHN20283.1| COBW domain-containing protein 2 [Glycine soja] Length = 306 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPRINKIVFIGK LDAKELE+GFKACLL Sbjct: 277 PDEPRINKIVFIGKKLDAKELEKGFKACLL 306 >ref|XP_003556540.1| PREDICTED: COBW domain-containing protein 1-like [Glycine max] Length = 445 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPRINKIVFIGK LDAKELE+GFKACLL Sbjct: 416 PDEPRINKIVFIGKKLDAKELEKGFKACLL 445 >ref|XP_008454190.1| PREDICTED: COBW domain-containing protein 1 [Cucumis melo] Length = 450 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPRINKIVFIGKNLD +ELE+GFKACLL Sbjct: 421 PDEPRINKIVFIGKNLDGEELEKGFKACLL 450 >ref|XP_004152183.1| PREDICTED: COBW domain-containing protein 1 [Cucumis sativus] gi|700197769|gb|KGN52927.1| hypothetical protein Csa_4G006340 [Cucumis sativus] Length = 451 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPRINKIVFIGKNLD +ELE+GFKACLL Sbjct: 421 PDEPRINKIVFIGKNLDGEELEKGFKACLL 450 >gb|KOM36529.1| hypothetical protein LR48_Vigan02g267900 [Vigna angularis] Length = 437 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 252 DEPRINKIVFIGKNLDAKELEEGFKACLL 166 DEPRINKIVFIGKNLDAKELE+GFKACL+ Sbjct: 409 DEPRINKIVFIGKNLDAKELEKGFKACLI 437 >ref|XP_007142702.1| hypothetical protein PHAVU_007G009700g [Phaseolus vulgaris] gi|561015892|gb|ESW14696.1| hypothetical protein PHAVU_007G009700g [Phaseolus vulgaris] Length = 448 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPRINKIVFIGKNLDA +LE+GFKACLL Sbjct: 419 PDEPRINKIVFIGKNLDAMDLEKGFKACLL 448 >ref|XP_002517699.1| prli-interacting factor l, putative [Ricinus communis] gi|223543331|gb|EEF44863.1| prli-interacting factor l, putative [Ricinus communis] Length = 426 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPRINKIVFIGKNL+A+E+E+GFKACLL Sbjct: 397 PDEPRINKIVFIGKNLEAQEIEKGFKACLL 426 >gb|KNA17661.1| hypothetical protein SOVF_077890 [Spinacia oleracea] Length = 470 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDE RINKIVFIGKNLD++ELEEGFKACLL Sbjct: 441 PDESRINKIVFIGKNLDSQELEEGFKACLL 470 >ref|XP_010097171.1| hypothetical protein L484_025717 [Morus notabilis] gi|587878231|gb|EXB67238.1| hypothetical protein L484_025717 [Morus notabilis] Length = 460 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPR++KIVFIGKNLD KELEEGFK CLL Sbjct: 431 PDEPRVSKIVFIGKNLDKKELEEGFKGCLL 460 >ref|XP_007023311.1| Plastid transcriptionally active 17 isoform 1 [Theobroma cacao] gi|508778677|gb|EOY25933.1| Plastid transcriptionally active 17 isoform 1 [Theobroma cacao] Length = 466 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPR+NKIVFIGKNL+A+ELE GFKACLL Sbjct: 437 PDEPRVNKIVFIGKNLNAQELESGFKACLL 466 >ref|XP_011073380.1| PREDICTED: COBW domain-containing protein 1 [Sesamum indicum] Length = 466 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 252 DEPRINKIVFIGKNLDAKELEEGFKACLL 166 DEPRINK+VFIGKNLDAKELE+GFK+CLL Sbjct: 438 DEPRINKLVFIGKNLDAKELEKGFKSCLL 466 >ref|XP_011044876.1| PREDICTED: COBW domain-containing protein 1 isoform X2 [Populus euphratica] Length = 436 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 P+EPR+NKIVFIGKNLDA+ELE+GFKACLL Sbjct: 407 PNEPRMNKIVFIGKNLDAQELEKGFKACLL 436 >ref|XP_011044875.1| PREDICTED: COBW domain-containing protein 1 isoform X1 [Populus euphratica] Length = 440 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 P+EPR+NKIVFIGKNLDA+ELE+GFKACLL Sbjct: 411 PNEPRMNKIVFIGKNLDAQELEKGFKACLL 440 >ref|XP_012073113.1| PREDICTED: COBW domain-containing protein 1 [Jatropha curcas] gi|643729154|gb|KDP37034.1| hypothetical protein JCGZ_06090 [Jatropha curcas] Length = 457 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 255 PDEPRINKIVFIGKNLDAKELEEGFKACLL 166 PDEPRINKIVFIGKNLDA+E+E+GFK CLL Sbjct: 428 PDEPRINKIVFIGKNLDAQEIEKGFKDCLL 457 >ref|XP_006341395.1| PREDICTED: COBW domain-containing protein 1-like [Solanum tuberosum] Length = 454 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 252 DEPRINKIVFIGKNLDAKELEEGFKACL 169 DEPR NKIVFIGKNLDAKELEEGFKACL Sbjct: 426 DEPRTNKIVFIGKNLDAKELEEGFKACL 453 >ref|XP_004235904.1| PREDICTED: COBW domain-containing protein 1 [Solanum lycopersicum] Length = 459 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 252 DEPRINKIVFIGKNLDAKELEEGFKACL 169 DEPR NKIVFIGKNLDAKELEEGFKACL Sbjct: 431 DEPRTNKIVFIGKNLDAKELEEGFKACL 458