BLASTX nr result
ID: Wisteria21_contig00009542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009542 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535305.1| conserved hypothetical protein [Ricinus comm... 72 2e-15 ref|XP_010109264.1| hypothetical protein L484_014858 [Morus nota... 63 6e-12 ref|XP_010106156.1| hypothetical protein L484_012700 [Morus nota... 69 1e-09 gb|KQK85818.1| hypothetical protein SETIT_020754mg [Setaria ital... 48 2e-09 gb|KJB09767.1| hypothetical protein B456_001G163400 [Gossypium r... 44 3e-09 ref|XP_010086905.1| hypothetical protein L484_005490 [Morus nota... 60 5e-07 ref|XP_002539361.1| conserved hypothetical protein [Ricinus comm... 52 4e-06 >ref|XP_002535305.1| conserved hypothetical protein [Ricinus communis] gi|223523491|gb|EEF27078.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 71.6 bits (174), Expect(2) = 2e-15 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -1 Query: 190 RRGSQYLFFQACSDIRFPRKIK*VSRVMGNLPARFGEH 77 R+ YLFFQACSDIRFPRKIK VSRVMGNLPARFGEH Sbjct: 146 RKAGSYLFFQACSDIRFPRKIKLVSRVMGNLPARFGEH 183 Score = 37.0 bits (84), Expect(2) = 2e-15 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 264 KKGPKHGGCRTLEWQRK 214 KKGPKH CRTLEWQRK Sbjct: 131 KKGPKHLRCRTLEWQRK 147 >ref|XP_010109264.1| hypothetical protein L484_014858 [Morus notabilis] gi|587934589|gb|EXC21503.1| hypothetical protein L484_014858 [Morus notabilis] Length = 116 Score = 62.8 bits (151), Expect(2) = 6e-12 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 190 RRGSQYLFFQACSDIRFPRKIK*VSRVMGNLPARFGEH 77 R+ YLFFQACSDI FP KIK VSRVMGNLPA+FGEH Sbjct: 79 RKTRSYLFFQACSDIWFPWKIKLVSRVMGNLPAQFGEH 116 Score = 34.3 bits (77), Expect(2) = 6e-12 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 261 KGPKHGGCRTLEWQRK 214 +G KHG CRTLEWQRK Sbjct: 65 EGAKHGRCRTLEWQRK 80 >ref|XP_010106156.1| hypothetical protein L484_012700 [Morus notabilis] gi|587920815|gb|EXC08244.1| hypothetical protein L484_012700 [Morus notabilis] Length = 255 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 193 IRRGSQYLFFQACSDIRFPRKIK*VSRVMGNLPARFGEH 77 ++ G +YLFFQACSDIRFPRKIK VSR MGNLPARFGEH Sbjct: 217 MQAGMEYLFFQACSDIRFPRKIKLVSRGMGNLPARFGEH 255 >gb|KQK85818.1| hypothetical protein SETIT_020754mg [Setaria italica] Length = 561 Score = 47.8 bits (112), Expect(2) = 2e-09 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 2/36 (5%) Frame = -1 Query: 190 RRGSQYLFFQACS--DIRFPRKIK*VSRVMGNLPAR 89 R+ Y F QACS IRFP+KIK VSRVMGNLPAR Sbjct: 123 RKARPYFFCQACSYISIRFPQKIKLVSRVMGNLPAR 158 Score = 40.8 bits (94), Expect(2) = 2e-09 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 264 KKGPKHGGCRTLEWQRK 214 KKGPKHG CRTLEWQRK Sbjct: 108 KKGPKHGRCRTLEWQRK 124 >gb|KJB09767.1| hypothetical protein B456_001G163400 [Gossypium raimondii] Length = 679 Score = 43.9 bits (102), Expect(2) = 3e-09 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 264 KKGPKHGGCRTLEWQRK 214 KKGPKHGGCRTLEWQRK Sbjct: 266 KKGPKHGGCRTLEWQRK 282 Score = 43.9 bits (102), Expect(2) = 3e-09 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -1 Query: 190 RRGSQYLFFQACSDIRFPRKIK*VSR 113 R+ YLFFQAC DIRFPRKIK VSR Sbjct: 281 RKAGSYLFFQACLDIRFPRKIKLVSR 306 >ref|XP_010086905.1| hypothetical protein L484_005490 [Morus notabilis] gi|587833891|gb|EXB24696.1| hypothetical protein L484_005490 [Morus notabilis] Length = 1260 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = -3 Query: 224 GKGKV*SNSTDKERESVPLFPGLFGHTVPAEDQVGEPCDGKPSRTVRRALN 72 G G+V N + + GLFGHTVP EDQVGE CDGKPS TVRRALN Sbjct: 305 GGGRVSINVFSRHDNTQFFVHGLFGHTVPVEDQVGELCDGKPSCTVRRALN 355 >ref|XP_002539361.1| conserved hypothetical protein [Ricinus communis] gi|223506854|gb|EEF23023.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 170 LFPGLFGHTVPAEDQVGEPCDGKPSRT 90 LF GHTVPAEDQVGEPCDGKPSRT Sbjct: 14 LFSRPVGHTVPAEDQVGEPCDGKPSRT 40 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 33 GSSLDSQIGPT 1 GSSLDSQIGPT Sbjct: 41 GSSLDSQIGPT 51