BLASTX nr result
ID: Wisteria21_contig00008999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00008999 (432 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007160347.1| hypothetical protein PHAVU_002G3141000g, par... 57 7e-06 gb|KHN21546.1| Aldehyde dehydrogenase family 2 member C4 [Glycin... 56 9e-06 ref|XP_006579386.1| PREDICTED: uncharacterized protein LOC100527... 56 9e-06 >ref|XP_007160347.1| hypothetical protein PHAVU_002G3141000g, partial [Phaseolus vulgaris] gi|561033762|gb|ESW32341.1| hypothetical protein PHAVU_002G3141000g, partial [Phaseolus vulgaris] Length = 450 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 374 ELAGIPDRGLKVVPGFGPTVGAAISSHMDIDA 279 +LAGIPD L VVPGFGPT GAAISSHMDIDA Sbjct: 158 KLAGIPDGVLNVVPGFGPTAGAAISSHMDIDA 189 >gb|KHN21546.1| Aldehyde dehydrogenase family 2 member C4 [Glycine soja] Length = 504 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 374 ELAGIPDRGLKVVPGFGPTVGAAISSHMDIDA 279 +LAGIPD L +VPGFGPT GAAISSHMDIDA Sbjct: 212 KLAGIPDGVLNIVPGFGPTAGAAISSHMDIDA 243 >ref|XP_006579386.1| PREDICTED: uncharacterized protein LOC100527654 isoform X1 [Glycine max] gi|947111969|gb|KRH60295.1| hypothetical protein GLYMA_05G231900 [Glycine max] Length = 538 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 374 ELAGIPDRGLKVVPGFGPTVGAAISSHMDIDA 279 +LAGIPD L +VPGFGPT GAAISSHMDIDA Sbjct: 246 KLAGIPDGVLNIVPGFGPTAGAAISSHMDIDA 277