BLASTX nr result
ID: Wisteria21_contig00008896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00008896 (252 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004495709.1| PREDICTED: protein RALF-like 33 [Cicer ariet... 60 5e-07 >ref|XP_004495709.1| PREDICTED: protein RALF-like 33 [Cicer arietinum] Length = 120 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 114 SAPXVAMSWSPTVVAGGEHHNVGMGWVPFTKAACKGSIGECLEGEE 251 +A +AMS+S T VAGG+H +GMGW+P TKA C+GSI ECLE +E Sbjct: 15 AAILLAMSFSRTAVAGGDHQ-LGMGWLPLTKAVCEGSIAECLEDDE 59