BLASTX nr result
ID: Wisteria21_contig00008265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00008265 (382 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRT82477.1| hypothetical protein AMK59_4510 [Oryctes borbonicus] 75 2e-11 gb|KOX71796.1| Protein translation factor SUI1 like protein, par... 75 2e-11 ref|XP_012287457.1| PREDICTED: protein translation factor SUI1 h... 75 2e-11 ref|XP_012223941.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 75 2e-11 ref|XP_012062422.1| PREDICTED: protein translation factor SUI1 h... 75 2e-11 ref|XP_011883070.1| PREDICTED: LOW QUALITY PROTEIN: protein tran... 75 2e-11 ref|XP_011695164.1| PREDICTED: LOW QUALITY PROTEIN: protein tran... 75 2e-11 ref|XP_011647975.1| PREDICTED: LOW QUALITY PROTEIN: protein tran... 75 2e-11 ref|XP_011257191.1| PREDICTED: LOW QUALITY PROTEIN: protein tran... 75 2e-11 ref|XP_011056576.1| PREDICTED: protein translation factor SUI1 h... 75 2e-11 ref|XP_002432016.1| translation factor sui1, putative [Pediculus... 75 2e-11 ref|XP_003486256.1| PREDICTED: protein translation factor SUI1 h... 75 2e-11 ref|XP_001863732.1| eukaryotic translation initiation factor 1b ... 75 2e-11 ref|XP_001661080.1| AAEL010843-PA [Aedes aegypti] gi|55982003|gb... 75 2e-11 ref|XP_014239437.1| PREDICTED: protein translation factor SUI1 h... 74 4e-11 gb|KNC32349.1| hypothetical protein FF38_11121 [Lucilia cuprina] 74 4e-11 ref|XP_014298848.1| PREDICTED: protein translation factor SUI1 h... 74 4e-11 ref|XP_014271392.1| PREDICTED: protein translation factor SUI1 h... 74 4e-11 ref|XP_004519899.1| PREDICTED: protein translation factor SUI1 h... 74 4e-11 gb|ENN73110.1| hypothetical protein YQE_10251, partial [Dendroct... 74 4e-11 >gb|KRT82477.1| hypothetical protein AMK59_4510 [Oryctes borbonicus] Length = 110 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 110 >gb|KOX71796.1| Protein translation factor SUI1 like protein, partial [Melipona quadrifasciata] Length = 94 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 61 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 94 >ref|XP_012287457.1| PREDICTED: protein translation factor SUI1 homolog [Orussus abietinus] Length = 110 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 110 >ref|XP_012223941.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105673125 [Linepithema humile] Length = 250 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 217 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 250 >ref|XP_012062422.1| PREDICTED: protein translation factor SUI1 homolog, partial [Atta cephalotes] Length = 207 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 174 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 207 >ref|XP_011883070.1| PREDICTED: LOW QUALITY PROTEIN: protein translation factor SUI1 homolog, partial [Vollenhovia emeryi] Length = 198 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 165 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 198 >ref|XP_011695164.1| PREDICTED: LOW QUALITY PROTEIN: protein translation factor SUI1 homolog, partial [Wasmannia auropunctata] Length = 195 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 162 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 195 >ref|XP_011647975.1| PREDICTED: LOW QUALITY PROTEIN: protein translation factor SUI1 homolog [Pogonomyrmex barbatus] Length = 209 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 176 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 209 >ref|XP_011257191.1| PREDICTED: LOW QUALITY PROTEIN: protein translation factor SUI1 homolog [Camponotus floridanus] Length = 219 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 186 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 219 >ref|XP_011056576.1| PREDICTED: protein translation factor SUI1 homolog [Acromyrmex echinatior] Length = 209 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 176 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 209 >ref|XP_002432016.1| translation factor sui1, putative [Pediculus humanus corporis] gi|212517367|gb|EEB19278.1| translation factor sui1, putative [Pediculus humanus corporis] Length = 110 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 110 >ref|XP_003486256.1| PREDICTED: protein translation factor SUI1 homolog [Bombus impatiens] gi|571548220|ref|XP_006561629.1| PREDICTED: protein translation factor SUI1 homolog [Apis mellifera] gi|572313137|ref|XP_006622271.1| PREDICTED: protein translation factor SUI1 homolog [Apis dorsata] gi|644996086|ref|XP_008210868.1| PREDICTED: protein translation factor SUI1 homolog [Nasonia vitripennis] gi|644996089|ref|XP_008210869.1| PREDICTED: protein translation factor SUI1 homolog [Nasonia vitripennis] gi|644996091|ref|XP_008210870.1| PREDICTED: protein translation factor SUI1 homolog [Nasonia vitripennis] gi|644996094|ref|XP_008210871.1| PREDICTED: protein translation factor SUI1 homolog [Nasonia vitripennis] gi|644996096|ref|XP_008210872.1| PREDICTED: protein translation factor SUI1 homolog [Nasonia vitripennis] gi|749751566|ref|XP_011138094.1| PREDICTED: protein translation factor SUI1 homolog [Harpegnathos saltator] gi|755944210|ref|XP_011299380.1| PREDICTED: protein translation factor SUI1 homolog [Fopius arisanus] gi|759044265|ref|XP_011331044.1| PREDICTED: protein translation factor SUI1 homolog [Cerapachys biroi] gi|759044267|ref|XP_011331045.1| PREDICTED: protein translation factor SUI1 homolog [Cerapachys biroi] gi|766937880|ref|XP_011501415.1| PREDICTED: protein translation factor SUI1 homolog [Ceratosolen solmsi marchali] gi|805799911|ref|XP_012144256.1| PREDICTED: protein translation factor SUI1 homolog [Megachile rotundata] gi|808128551|ref|XP_012167152.1| PREDICTED: protein translation factor SUI1 homolog [Bombus terrestris] gi|817068697|ref|XP_012256299.1| PREDICTED: protein translation factor SUI1 homolog [Athalia rosae] gi|820861937|ref|XP_012347729.1| PREDICTED: protein translation factor SUI1 homolog [Apis florea] gi|826471572|ref|XP_012536237.1| PREDICTED: protein translation factor SUI1 homolog [Monomorium pharaonis] gi|936680703|ref|XP_014237366.1| PREDICTED: protein translation factor SUI1 homolog [Trichogramma pretiosum] gi|951540762|ref|XP_014473332.1| PREDICTED: protein translation factor SUI1 homolog [Dinoponera quadriceps] gi|307207800|gb|EFN85418.1| Protein translation factor SUI1-like protein [Harpegnathos saltator] gi|332024011|gb|EGI64229.1| Protein translation factor SUI1-like protein [Acromyrmex echinatior] gi|607365111|gb|EZA59313.1| Translation factor SUI1-like protein [Cerapachys biroi] gi|607365112|gb|EZA59314.1| Translation factor SUI1-like protein [Cerapachys biroi] gi|861654601|gb|KMR00156.1| protein translation factor sui1-like protein [Lasius niger] gi|861655832|gb|KMR01324.1| translation factor sui1-like protein [Lasius niger] gi|915657305|gb|KOC60689.1| Protein translation factor SUI1 like protein [Habropoda laboriosa] Length = 110 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 110 >ref|XP_001863732.1| eukaryotic translation initiation factor 1b [Culex quinquefasciatus] gi|167875607|gb|EDS38990.1| eukaryotic translation initiation factor 1b [Culex quinquefasciatus] Length = 108 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 75 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 108 >ref|XP_001661080.1| AAEL010843-PA [Aedes aegypti] gi|55982003|gb|AAV69394.1| translation factor SUI1-like protein [Aedes aegypti] gi|108872909|gb|EAT37134.1| AAEL010843-PA [Aedes aegypti] Length = 110 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 110 >ref|XP_014239437.1| PREDICTED: protein translation factor SUI1 homolog [Cimex lectularius] Length = 110 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTK+GLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKTGLAKPDQLKVHGF 110 >gb|KNC32349.1| hypothetical protein FF38_11121 [Lucilia cuprina] Length = 110 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTK+GLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKAGLAKPDQLKVHGF 110 >ref|XP_014298848.1| PREDICTED: protein translation factor SUI1 homolog [Microplitis demolitor] Length = 110 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTK+GLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKAGLAKPDQLKVHGF 110 >ref|XP_014271392.1| PREDICTED: protein translation factor SUI1 homolog [Halyomorpha halys] gi|501290986|dbj|BAN20281.1| conserved hypothetical protein [Riptortus pedestris] Length = 110 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTK+GLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKTGLAKPDQLKVHGF 110 >ref|XP_004519899.1| PREDICTED: protein translation factor SUI1 homolog [Ceratitis capitata] gi|751452592|ref|XP_011180673.1| PREDICTED: protein translation factor SUI1 homolog [Bactrocera cucurbitae] gi|751783251|ref|XP_011200863.1| PREDICTED: protein translation factor SUI1 homolog [Bactrocera dorsalis] gi|929377637|ref|XP_014099057.1| PREDICTED: protein translation factor SUI1 homolog [Bactrocera oleae] Length = 110 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTK+GLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKAGLAKPDQLKVHGF 110 >gb|ENN73110.1| hypothetical protein YQE_10251, partial [Dendroctonus ponderosae] gi|546673857|gb|ERL85387.1| hypothetical protein D910_02807 [Dendroctonus ponderosae] Length = 110 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 381 GEVLQLQGDQRENICQWLTKSGLAKPDQLKVHGF 280 GEVLQLQGDQRENICQWLTK+GLAKPDQLKVHGF Sbjct: 77 GEVLQLQGDQRENICQWLTKAGLAKPDQLKVHGF 110