BLASTX nr result
ID: Wisteria21_contig00007830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00007830 (361 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN33926.1| Pentatricopeptide repeat-containing protein [Glyc... 117 3e-24 ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 ref|XP_014503863.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_008366695.1| PREDICTED: pentatricopeptide repeat-containi... 116 6e-24 ref|XP_008387666.1| PREDICTED: pentatricopeptide repeat-containi... 116 6e-24 ref|XP_008219679.1| PREDICTED: pentatricopeptide repeat-containi... 116 8e-24 ref|XP_007225539.1| hypothetical protein PRUPE_ppa026705mg [Prun... 116 8e-24 ref|XP_003588753.1| PPR containing plant-like protein [Medicago ... 115 1e-23 gb|KOM27755.1| hypothetical protein LR48_Vigan462s000800 [Vigna ... 115 1e-23 ref|XP_007161217.1| hypothetical protein PHAVU_001G0518001g, par... 115 1e-23 ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_010103704.1| hypothetical protein L484_001891 [Morus nota... 115 2e-23 ref|XP_010250083.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_012447551.1| PREDICTED: pentatricopeptide repeat-containi... 113 5e-23 ref|XP_011039733.1| PREDICTED: pentatricopeptide repeat-containi... 113 5e-23 emb|CDP13497.1| unnamed protein product [Coffea canephora] 112 1e-22 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 112 1e-22 >gb|KHN33926.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 402 Score = 117 bits (293), Expect = 3e-24 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFK+GLCSC DFW Sbjct: 349 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCGDFW 402 >ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Glycine max] gi|571538394|ref|XP_006601144.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X2 [Glycine max] gi|571538398|ref|XP_006601145.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X3 [Glycine max] gi|571538402|ref|XP_006601146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X4 [Glycine max] gi|947055695|gb|KRH05148.1| hypothetical protein GLYMA_17G209700 [Glycine max] gi|947055696|gb|KRH05149.1| hypothetical protein GLYMA_17G209700 [Glycine max] Length = 615 Score = 117 bits (293), Expect = 3e-24 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFK+GLCSC DFW Sbjct: 562 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCGDFW 615 >ref|XP_014503863.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vigna radiata var. radiata] Length = 616 Score = 117 bits (292), Expect = 4e-24 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -3 Query: 359 APGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 APGTPIRIVKNLRVCEDCHSATKFISKVY+REIVVRDRNRFHHFK+GLCSC DFW Sbjct: 562 APGTPIRIVKNLRVCEDCHSATKFISKVYSREIVVRDRNRFHHFKNGLCSCGDFW 616 >ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Fragaria vesca subsp. vesca] Length = 588 Score = 117 bits (292), Expect = 4e-24 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVCEDCHSATKFISK+YNREIVVRDRNRFHHFK+GLCSCK FW Sbjct: 535 PGTPIRIVKNLRVCEDCHSATKFISKIYNREIVVRDRNRFHHFKNGLCSCKGFW 588 >ref|XP_008366695.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like, partial [Malus domestica] Length = 366 Score = 116 bits (291), Expect = 6e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC+DCHSATKFISKVYNREIVVRDRNRFHHFK G+CSC+DFW Sbjct: 313 PGTPIRIVKNLRVCDDCHSATKFISKVYNREIVVRDRNRFHHFKDGMCSCRDFW 366 >ref|XP_008387666.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Malus domestica] Length = 595 Score = 116 bits (291), Expect = 6e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC+DCHSATKFISKVYNREIVVRDRNRFHHFK G+CSC+DFW Sbjct: 542 PGTPIRIVKNLRVCDDCHSATKFISKVYNREIVVRDRNRFHHFKDGMCSCRDFW 595 >ref|XP_008219679.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Prunus mume] Length = 606 Score = 116 bits (290), Expect = 8e-24 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC+DCHSATKFISK+YNREIVVRDRNRFHHFK G+CSC+DFW Sbjct: 553 PGTPIRIVKNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKDGMCSCRDFW 606 >ref|XP_007225539.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] gi|462422475|gb|EMJ26738.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] Length = 484 Score = 116 bits (290), Expect = 8e-24 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC+DCHSATKFISK+YNREIVVRDRNRFHHFK G+CSC+DFW Sbjct: 431 PGTPIRIVKNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKDGMCSCRDFW 484 >ref|XP_003588753.1| PPR containing plant-like protein [Medicago truncatula] gi|355477801|gb|AES59004.1| PPR containing plant-like protein [Medicago truncatula] Length = 600 Score = 115 bits (289), Expect = 1e-23 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGT IRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFK+GLCSC+DFW Sbjct: 547 PGTSIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 600 >gb|KOM27755.1| hypothetical protein LR48_Vigan462s000800 [Vigna angularis] Length = 616 Score = 115 bits (288), Expect = 1e-23 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVCEDCHSATKFISKVY+REIVVRDRNRFHHFK+GLCSC DFW Sbjct: 563 PGTPIRIVKNLRVCEDCHSATKFISKVYSREIVVRDRNRFHHFKNGLCSCGDFW 616 >ref|XP_007161217.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] gi|561034681|gb|ESW33211.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] Length = 380 Score = 115 bits (288), Expect = 1e-23 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVCEDCHSATKFISKVY+REIVVRDRNRFHHFK+GLCSC DFW Sbjct: 327 PGTPIRIVKNLRVCEDCHSATKFISKVYSREIVVRDRNRFHHFKNGLCSCGDFW 380 >ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 609 Score = 115 bits (288), Expect = 1e-23 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGT IRIVKNLR+CEDCHSATKFISKVYNREIVVRDRNRFHHFK+GLCSC+DFW Sbjct: 556 PGTSIRIVKNLRICEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 609 >ref|XP_010103704.1| hypothetical protein L484_001891 [Morus notabilis] gi|587908850|gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] Length = 599 Score = 115 bits (287), Expect = 2e-23 Identities = 50/54 (92%), Positives = 51/54 (94%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC DCHSATKFISK+YNREIVVRDRNRFHHF GLCSCKDFW Sbjct: 546 PGTPIRIVKNLRVCSDCHSATKFISKIYNREIVVRDRNRFHHFMDGLCSCKDFW 599 >ref|XP_010250083.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nelumbo nucifera] Length = 631 Score = 114 bits (286), Expect = 2e-23 Identities = 51/54 (94%), Positives = 51/54 (94%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC DCHSATKFISKVYNREIVVRDRNRFHHFK G CSCKDFW Sbjct: 578 PGTPIRIVKNLRVCGDCHSATKFISKVYNREIVVRDRNRFHHFKDGSCSCKDFW 631 >ref|XP_012447551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Gossypium raimondii] gi|763787997|gb|KJB54993.1| hypothetical protein B456_009G057300 [Gossypium raimondii] Length = 610 Score = 113 bits (283), Expect = 5e-23 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC DCHSATKFISK+YNREI+ RDR+RFHHFK GLCSCKDFW Sbjct: 557 PGTPIRIVKNLRVCNDCHSATKFISKIYNREIIARDRSRFHHFKDGLCSCKDFW 610 >ref|XP_011039733.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Populus euphratica] Length = 630 Score = 113 bits (283), Expect = 5e-23 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGT IRIVKNLRVC+DCHSATKFISK+YNREIVVRDRNRFHHFK+GLCSC+DFW Sbjct: 577 PGTLIRIVKNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKNGLCSCRDFW 630 >emb|CDP13497.1| unnamed protein product [Coffea canephora] Length = 608 Score = 112 bits (279), Expect = 1e-22 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGT IRIVKNLRVCEDCH+ATKFISK+YNREIVVRDRNRFHHF GLCSCKDFW Sbjct: 555 PGTSIRIVKNLRVCEDCHTATKFISKIYNREIVVRDRNRFHHFIDGLCSCKDFW 608 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 112 bits (279), Expect = 1e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC DCHSATKFISK+YNREIVVRDR+RFHHFK G CSC+DFW Sbjct: 513 PGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 112 bits (279), Expect = 1e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC DCHSATKFISK+YNREIVVRDR+RFHHFK G CSC+DFW Sbjct: 547 PGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 600 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 112 bits (279), Expect = 1e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = -3 Query: 356 PGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKSGLCSCKDFW 195 PGTPIRIVKNLRVC DCHSATKFISK+YNREIVVRDR+RFHHFK G CSC+DFW Sbjct: 576 PGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 629