BLASTX nr result
ID: Wisteria21_contig00007503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00007503 (587 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128... 84 4e-14 ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583... 82 2e-13 ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763... 82 3e-13 ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610... 81 3e-13 ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595... 80 8e-13 ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997... 80 1e-12 ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973... 79 1e-12 ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247... 79 2e-12 ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968... 79 2e-12 ref|XP_014523456.1| PREDICTED: uncharacterized protein LOC106779... 79 2e-12 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 78 3e-12 ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240... 78 4e-12 ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104... 78 4e-12 ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703... 78 4e-12 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 78 4e-12 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 78 4e-12 ref|XP_010664724.1| PREDICTED: uncharacterized protein LOC104882... 77 6e-12 ref|XP_009396322.1| PREDICTED: uncharacterized protein LOC103981... 77 6e-12 ref|XP_014504913.1| PREDICTED: uncharacterized protein LOC106764... 77 8e-12 ref|XP_009404012.1| PREDICTED: uncharacterized protein LOC103987... 76 1e-11 >ref|XP_011028507.1| PREDICTED: uncharacterized protein LOC105128494 [Populus euphratica] Length = 41 Score = 84.3 bits (207), Expect = 4e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 M+PV+CEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVLCEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010233766.1| PREDICTED: uncharacterized protein LOC104583416 [Brachypodium distachyon] gi|944057566|gb|KQJ93156.1| hypothetical protein BRADI_3g02990 [Brachypodium distachyon] Length = 41 Score = 82.4 bits (202), Expect = 2e-13 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPVI EILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_012436849.1| PREDICTED: uncharacterized protein LOC105763252 [Gossypium raimondii] Length = 41 Score = 81.6 bits (200), Expect = 3e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPV+ EILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010275578.1| PREDICTED: uncharacterized protein LOC104610579 [Nelumbo nucifera] Length = 41 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSP++ EILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010254729.1| PREDICTED: uncharacterized protein LOC104595623 [Nelumbo nucifera] Length = 41 Score = 80.1 bits (196), Expect = 8e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSP++ EILLSGFMINS+LRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPIVSEILLSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009417020.1| PREDICTED: uncharacterized protein LOC103997494 [Musa acuminata subsp. malaccensis] Length = 41 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSP++ EILLSGFMINSTLRRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMINSTLRRRSHLVQSFSVVFLYWFYVFS 41 >ref|XP_009386487.1| PREDICTED: uncharacterized protein LOC103973592 [Musa acuminata subsp. malaccensis] Length = 41 Score = 79.3 bits (194), Expect = 1e-12 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPV+ EIL SGFMINSTLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002276079.2| PREDICTED: uncharacterized protein LOC100247207 [Vitis vinifera] Length = 41 Score = 79.0 bits (193), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPV+ E+L SGFMINSTLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEVLRSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009380389.1| PREDICTED: uncharacterized protein LOC103968797 [Musa acuminata subsp. malaccensis] Length = 41 Score = 79.0 bits (193), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSP++ EILL GFMINSTLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLLGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_014523456.1| PREDICTED: uncharacterized protein LOC106779778 [Vigna radiata var. radiata] Length = 42 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 235 SPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 SPVICEILLSGF INS+LRRRTHLVQSFSVVFL+WFYVFS Sbjct: 3 SPVICEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVFS 42 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|590593628|ref|XP_007017623.1| Peptide upstream open reading frame 5 [Theobroma cacao] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 78.2 bits (191), Expect = 3e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPV+ EIL SGFMINS+LRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009793690.1| PREDICTED: uncharacterized protein LOC104240532 [Nicotiana sylvestris] Length = 45 Score = 77.8 bits (190), Expect = 4e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPVI E+LLSGF INSTL RRTHLVQSFSVVFLYWFYVFS Sbjct: 5 MSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_009611011.1| PREDICTED: uncharacterized protein LOC104104584 [Nicotiana tomentosiformis] Length = 45 Score = 77.8 bits (190), Expect = 4e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPVI E+LLSGF INSTL RRTHLVQSFSVVFLYWFYVFS Sbjct: 5 MSPVISEVLLSGFTINSTLHRRTHLVQSFSVVFLYWFYVFS 45 >ref|XP_008784952.1| PREDICTED: uncharacterized protein LOC103703760 [Phoenix dactylifera] gi|672144149|ref|XP_008795970.1| PREDICTED: uncharacterized protein LOC103711555 [Phoenix dactylifera] Length = 41 Score = 77.8 bits (190), Expect = 4e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSP++ EILLSGFMI+S+LRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPILSEILLSGFMISSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 77.8 bits (190), Expect = 4e-12 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPVICEI SGFMINSTLRRRTHLVQSFSVVFLYWFY+FS Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWFYIFS 39 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|593795374|ref|XP_007160725.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|731312172|ref|XP_010672909.1| PREDICTED: uncharacterized protein LOC104889396 [Beta vulgaris subsp. vulgaris] gi|747073329|ref|XP_011083620.1| PREDICTED: uncharacterized protein LOC105166091 [Sesamum indicum] gi|802595010|ref|XP_012071924.1| PREDICTED: uncharacterized protein LOC105633842 [Jatropha curcas] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|870869972|gb|KMT20717.1| hypothetical protein BVRB_1g006920 [Beta vulgaris subsp. vulgaris] gi|947066007|gb|KRH15150.1| hypothetical protein GLYMA_14G071500 [Glycine max] Length = 41 Score = 77.8 bits (190), Expect = 4e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPV+ EIL SGFMINS+LRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_010664724.1| PREDICTED: uncharacterized protein LOC104882564 [Vitis vinifera] Length = 41 Score = 77.0 bits (188), Expect = 6e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPV+ EIL SGFMINS+L+RRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLKRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_009396322.1| PREDICTED: uncharacterized protein LOC103981344 [Musa acuminata subsp. malaccensis] Length = 41 Score = 77.0 bits (188), Expect = 6e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MS +I EILLSGFMI+STLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSAIISEILLSGFMISSTLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_014504913.1| PREDICTED: uncharacterized protein LOC106764966 [Vigna radiata var. radiata] Length = 41 Score = 76.6 bits (187), Expect = 8e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MSPV+ EIL SGFMINS+LRRRTHLVQSFSV+FLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVLFLYWFYVFS 41 >ref|XP_009404012.1| PREDICTED: uncharacterized protein LOC103987431 [Musa acuminata subsp. malaccensis] Length = 41 Score = 76.3 bits (186), Expect = 1e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 238 MSPVICEILLSGFMINSTLRRRTHLVQSFSVVFLYWFYVFS 116 MS ++ EILLSGFMI+STLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSAILSEILLSGFMISSTLRRRTHLVQSFSVVFLYWFYVFS 41