BLASTX nr result
ID: Wisteria21_contig00007114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00007114 (473 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013459848.1| proline synthetase associated protein [Medic... 97 4e-18 ref|XP_004513878.1| PREDICTED: proline synthase co-transcribed b... 97 4e-18 ref|XP_007146512.1| hypothetical protein PHAVU_006G047100g [Phas... 97 5e-18 ref|XP_006602187.1| PREDICTED: 1,4-alpha-glucan-branching enzyme... 97 6e-18 gb|KRG98709.1| hypothetical protein GLYMA_18G092500 [Glycine max] 96 8e-18 gb|KHN12521.1| Proline synthase co-transcribed bacterial like pr... 96 8e-18 ref|XP_003532139.1| PREDICTED: proline synthase co-transcribed b... 96 8e-18 ref|XP_008449125.1| PREDICTED: proline synthase co-transcribed b... 96 1e-17 ref|XP_014521857.1| PREDICTED: proline synthase co-transcribed b... 93 7e-17 ref|XP_004149336.1| PREDICTED: proline synthase co-transcribed b... 93 7e-17 ref|XP_010099175.1| hypothetical protein L484_014173 [Morus nota... 91 3e-16 ref|XP_010644485.1| PREDICTED: proline synthase co-transcribed b... 91 3e-16 ref|XP_002278892.1| PREDICTED: proline synthase co-transcribed b... 91 3e-16 emb|CAN80917.1| hypothetical protein VITISV_024616 [Vitis vinifera] 91 3e-16 ref|XP_008226849.1| PREDICTED: proline synthase co-transcribed b... 91 4e-16 ref|XP_007211920.1| hypothetical protein PRUPE_ppa010565mg [Prun... 91 4e-16 ref|XP_011046973.1| PREDICTED: proline synthase co-transcribed b... 90 6e-16 ref|XP_009358266.1| PREDICTED: proline synthase co-transcribed b... 90 6e-16 ref|XP_008440036.1| PREDICTED: proline synthase co-transcribed b... 90 8e-16 gb|KDO62088.1| hypothetical protein CISIN_1g0259871mg, partial [... 90 8e-16 >ref|XP_013459848.1| proline synthetase associated protein [Medicago truncatula] gi|657393003|gb|KEH33879.1| proline synthetase associated protein [Medicago truncatula] Length = 244 Score = 97.4 bits (241), Expect = 4e-18 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKALEMDEEQCELSMGMSGDFELAIE GSTNVR+GSTIFGPREYAKK+ Sbjct: 196 VCKALEMDEEQCELSMGMSGDFELAIESGSTNVRVGSTIFGPREYAKKQ 244 >ref|XP_004513878.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Cicer arietinum] Length = 244 Score = 97.4 bits (241), Expect = 4e-18 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKALEMDEEQCELSMGMSGDFELAIE GSTNVR+GSTIFGPREYAKK+ Sbjct: 196 VCKALEMDEEQCELSMGMSGDFELAIESGSTNVRVGSTIFGPREYAKKQ 244 >ref|XP_007146512.1| hypothetical protein PHAVU_006G047100g [Phaseolus vulgaris] gi|561019735|gb|ESW18506.1| hypothetical protein PHAVU_006G047100g [Phaseolus vulgaris] Length = 245 Score = 97.1 bits (240), Expect = 5e-18 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKKE 322 VCKALEM EEQCELSMGMSGDFELAIEMGSTNVR+GSTIFGPREY KK+E Sbjct: 196 VCKALEMPEEQCELSMGMSGDFELAIEMGSTNVRVGSTIFGPREYPKKQE 245 >ref|XP_006602187.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic-like isoform X2 [Glycine max] Length = 596 Score = 96.7 bits (239), Expect = 6e-18 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKKE*Q 316 VCKALEM EE+CELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKK+ Q Sbjct: 196 VCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKQHYQ 247 >gb|KRG98709.1| hypothetical protein GLYMA_18G092500 [Glycine max] Length = 244 Score = 96.3 bits (238), Expect = 8e-18 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKALEM EE+CELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKK+ Sbjct: 196 VCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKQ 244 >gb|KHN12521.1| Proline synthase co-transcribed bacterial like protein [Glycine soja] Length = 209 Score = 96.3 bits (238), Expect = 8e-18 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKALEM EE+CELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKK+ Sbjct: 161 VCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKQ 209 >ref|XP_003532139.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like isoformX1 [Glycine max] gi|947097641|gb|KRH46226.1| hypothetical protein GLYMA_08G319900 [Glycine max] Length = 244 Score = 96.3 bits (238), Expect = 8e-18 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKALEM EE+CELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKK+ Sbjct: 196 VCKALEMPEEECELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKQ 244 >ref|XP_008449125.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Cucumis melo] Length = 245 Score = 95.9 bits (237), Expect = 1e-17 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKK 328 VCKALEM+EEQCELSMGMS DFELAIEMGSTNVRIGSTIFGPREYAKK Sbjct: 195 VCKALEMEEEQCELSMGMSNDFELAIEMGSTNVRIGSTIFGPREYAKK 242 >ref|XP_014521857.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Vigna radiata var. radiata] Length = 245 Score = 93.2 bits (230), Expect = 7e-17 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKKE 322 VCKALE+ EE CELSMGMSGDFELAIEMGSTNVRIGSTIFGPREY KK+E Sbjct: 196 VCKALEIPEELCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYPKKQE 245 >ref|XP_004149336.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Cucumis sativus] gi|700200953|gb|KGN56086.1| hypothetical protein Csa_3G073290 [Cucumis sativus] Length = 245 Score = 93.2 bits (230), Expect = 7e-17 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKALEM EE+CELSMGMS DFELAIEMGSTNVRIGSTIFGPREYAKK+ Sbjct: 195 VCKALEMAEERCELSMGMSNDFELAIEMGSTNVRIGSTIFGPREYAKKQ 243 >ref|XP_010099175.1| hypothetical protein L484_014173 [Morus notabilis] gi|587888339|gb|EXB77047.1| hypothetical protein L484_014173 [Morus notabilis] Length = 316 Score = 90.9 bits (224), Expect = 3e-16 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKAL + EEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREY KK+ Sbjct: 267 VCKALGIAEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYPKKQ 315 >ref|XP_010644485.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein isoform X1 [Vitis vinifera] Length = 260 Score = 90.9 bits (224), Expect = 3e-16 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKKE 322 VCKAL M EEQCELSMGMSGDFE AIEMGSTNVRIGSTIFGPREY KK++ Sbjct: 210 VCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKEQ 259 >ref|XP_002278892.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein isoform X2 [Vitis vinifera] gi|297737470|emb|CBI26671.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 90.9 bits (224), Expect = 3e-16 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKKE 322 VCKAL M EEQCELSMGMSGDFE AIEMGSTNVRIGSTIFGPREY KK++ Sbjct: 195 VCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKEQ 244 >emb|CAN80917.1| hypothetical protein VITISV_024616 [Vitis vinifera] Length = 245 Score = 90.9 bits (224), Expect = 3e-16 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKKE 322 VCKAL M EEQCELSMGMSGDFE AIEMGSTNVRIGSTIFGPREY KK++ Sbjct: 195 VCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKEQ 244 >ref|XP_008226849.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Prunus mume] Length = 245 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKAL+M EE CELSMGMSGDFE AIEMGSTNVRIGSTIFGPR+YAKK+ Sbjct: 195 VCKALDMAEEHCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPRDYAKKQ 243 >ref|XP_007211920.1| hypothetical protein PRUPE_ppa010565mg [Prunus persica] gi|462407785|gb|EMJ13119.1| hypothetical protein PRUPE_ppa010565mg [Prunus persica] Length = 245 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKAL+M EE CELSMGMSGDFE AIEMGSTNVRIGSTIFGPR+YAKK+ Sbjct: 195 VCKALDMAEEHCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPRDYAKKQ 243 >ref|XP_011046973.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Populus euphratica] Length = 272 Score = 90.1 bits (222), Expect = 6e-16 Identities = 44/49 (89%), Positives = 45/49 (91%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKAL + EEQCELSMGMS DFE AIEMGSTNVRIGSTIFGPREYAKKK Sbjct: 224 VCKALGIPEEQCELSMGMSNDFEQAIEMGSTNVRIGSTIFGPREYAKKK 272 >ref|XP_009358266.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Pyrus x bretschneideri] Length = 274 Score = 90.1 bits (222), Expect = 6e-16 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKAL + EEQCELSMGMS DFELAIEMGSTNVRIGSTIFGPREY KK+ Sbjct: 226 VCKALRISEEQCELSMGMSSDFELAIEMGSTNVRIGSTIFGPREYPKKQ 274 >ref|XP_008440036.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Cucumis melo] gi|659079030|ref|XP_008440037.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Cucumis melo] Length = 246 Score = 89.7 bits (221), Expect = 8e-16 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKK 325 VCKALE+ EEQCELSMGMS DFELA+EMGSTNVR+GSTIFG REY KKK Sbjct: 198 VCKALEISEEQCELSMGMSADFELAVEMGSTNVRVGSTIFGAREYLKKK 246 >gb|KDO62088.1| hypothetical protein CISIN_1g0259871mg, partial [Citrus sinensis] gi|641843188|gb|KDO62089.1| hypothetical protein CISIN_1g0259871mg, partial [Citrus sinensis] gi|641843189|gb|KDO62090.1| hypothetical protein CISIN_1g0259871mg, partial [Citrus sinensis] gi|641843190|gb|KDO62091.1| hypothetical protein CISIN_1g0259871mg, partial [Citrus sinensis] Length = 59 Score = 89.7 bits (221), Expect = 8e-16 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -3 Query: 471 VCKALEMDEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGPREYAKKKE 322 VCKAL M E+QCELSMGMSGDFE AIEMGST+VRIGSTIFGPREYAKK++ Sbjct: 9 VCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAKKQQ 58