BLASTX nr result
ID: Wisteria21_contig00007061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00007061 (743 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621249.1| transmembrane protein, putative [Medicago tr... 75 5e-11 >ref|XP_003621249.1| transmembrane protein, putative [Medicago truncatula] gi|355496264|gb|AES77467.1| transmembrane protein, putative [Medicago truncatula] Length = 88 Score = 75.1 bits (183), Expect = 5e-11 Identities = 40/73 (54%), Positives = 46/73 (63%) Frame = -1 Query: 515 MGHSRXXXXXXXXXXXXXXFDYGFGRVVSMETVEHGDSTIAEIVEHDRIMRGIKVEIMDY 336 MGHSR F YGFGRV MET+E D +I +VEHDR MR + EIMDY Sbjct: 1 MGHSRFLVLLLVSSILFLSFGYGFGRVAMMETIEDKDVSIKGLVEHDRKMREV-YEIMDY 59 Query: 335 AEPEPNTNPKNGY 297 + PEPNTNPK+GY Sbjct: 60 SLPEPNTNPKSGY 72