BLASTX nr result
ID: Wisteria21_contig00006131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00006131 (241 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014520086.1| PREDICTED: chaperone protein dnaJ 11, chloro... 71 4e-10 gb|KOM28071.1| hypothetical protein LR48_Vigan499s001500 [Vigna ... 71 4e-10 gb|AAB36543.1| DnaJ-like protein [Phaseolus vulgaris] 71 4e-10 ref|XP_007157915.1| hypothetical protein PHAVU_002G108600g [Phas... 71 4e-10 ref|NP_001241283.1| uncharacterized protein LOC100800959 [Glycin... 71 4e-10 ref|XP_003517172.1| PREDICTED: chaperone protein dnaJ 11, chloro... 67 4e-09 ref|XP_004512137.1| PREDICTED: chaperone protein dnaJ 11, chloro... 60 8e-07 ref|XP_003612179.1| chaperone protein DnaJ 11 [Medicago truncatu... 56 9e-06 >ref|XP_014520086.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic [Vigna radiata var. radiata] Length = 160 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 240 NYDRSLFRRQRPLSTASIFSGYSSRNWETDQCW 142 NYDRSLFRRQRPLSTA++FSGY+ RNWETDQCW Sbjct: 128 NYDRSLFRRQRPLSTAAVFSGYTRRNWETDQCW 160 >gb|KOM28071.1| hypothetical protein LR48_Vigan499s001500 [Vigna angularis] Length = 160 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 240 NYDRSLFRRQRPLSTASIFSGYSSRNWETDQCW 142 NYDRSLFRRQRPLSTA++FSGY+ RNWETDQCW Sbjct: 128 NYDRSLFRRQRPLSTAAVFSGYTRRNWETDQCW 160 >gb|AAB36543.1| DnaJ-like protein [Phaseolus vulgaris] Length = 161 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 240 NYDRSLFRRQRPLSTASIFSGYSSRNWETDQCW 142 NYDRSLFRRQRPLSTA++FSGY+ RNWETDQCW Sbjct: 129 NYDRSLFRRQRPLSTAAVFSGYTRRNWETDQCW 161 >ref|XP_007157915.1| hypothetical protein PHAVU_002G108600g [Phaseolus vulgaris] gi|561031330|gb|ESW29909.1| hypothetical protein PHAVU_002G108600g [Phaseolus vulgaris] Length = 162 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 240 NYDRSLFRRQRPLSTASIFSGYSSRNWETDQCW 142 NYDRSLFRRQRPLSTA++FSGY+ RNWETDQCW Sbjct: 130 NYDRSLFRRQRPLSTAAVFSGYTRRNWETDQCW 162 >ref|NP_001241283.1| uncharacterized protein LOC100800959 [Glycine max] gi|255633852|gb|ACU17287.1| unknown [Glycine max] gi|947080013|gb|KRH28802.1| hypothetical protein GLYMA_11G077400 [Glycine max] Length = 158 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 240 NYDRSLFRRQRPLSTASIFSGYSSRNWETDQCW 142 NYDRSLFRRQRPLSTA++FSGY+ RNWETDQCW Sbjct: 126 NYDRSLFRRQRPLSTAAVFSGYTRRNWETDQCW 158 >ref|XP_003517172.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Glycine max] gi|947128801|gb|KRH76655.1| hypothetical protein GLYMA_01G166000 [Glycine max] Length = 158 Score = 67.4 bits (163), Expect = 4e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 240 NYDRSLFRRQRPLSTASIFSGYSSRNWETDQCW 142 NYD+ LFRRQRPLSTA++FSGY+ RNWETDQCW Sbjct: 126 NYDQRLFRRQRPLSTAAVFSGYTRRNWETDQCW 158 >ref|XP_004512137.1| PREDICTED: chaperone protein dnaJ 11, chloroplastic-like [Cicer arietinum] Length = 158 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 240 NYDRSLFRRQRPLSTASIFSGYSSRNWETDQCW 142 NYDRS+FRR RPLST + SGYSSR WETDQCW Sbjct: 128 NYDRSIFRRHRPLST--VMSGYSSRKWETDQCW 158 >ref|XP_003612179.1| chaperone protein DnaJ 11 [Medicago truncatula] gi|355513514|gb|AES95137.1| chaperone protein DnaJ 11 [Medicago truncatula] gi|388506520|gb|AFK41326.1| unknown [Medicago truncatula] Length = 168 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = -2 Query: 240 NYDRSLF-RRQRPLSTASIFS-GYSSRNWETDQCW 142 NYDRSLF RRQRPLS+++I S GYS R WETDQCW Sbjct: 134 NYDRSLFLRRQRPLSSSAIISSGYSGRKWETDQCW 168