BLASTX nr result
ID: Wisteria21_contig00005615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00005615 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494037.1| PREDICTED: uncharacterized protein LOC101491... 57 5e-06 ref|XP_003542609.1| PREDICTED: uncharacterized protein LOC100795... 57 7e-06 >ref|XP_004494037.1| PREDICTED: uncharacterized protein LOC101491743 [Cicer arietinum] Length = 278 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 261 ESVCSEPPGLSSMNRFASGRRSESWGVGKSEI 166 ESV SEP GL SMNRF SGRRSESWGVG+SEI Sbjct: 246 ESVYSEPAGLGSMNRFVSGRRSESWGVGESEI 277 >ref|XP_003542609.1| PREDICTED: uncharacterized protein LOC100795534 [Glycine max] gi|947071179|gb|KRH20070.1| hypothetical protein GLYMA_13G154300 [Glycine max] Length = 303 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/36 (80%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = -3 Query: 264 EESVCSE--PPGLSSMNRFASGRRSESWGVGKSEIH 163 EESV S PPGL SMNRFASGRRSESWGVG EIH Sbjct: 265 EESVSSAAAPPGLGSMNRFASGRRSESWGVGDYEIH 300