BLASTX nr result
ID: Wisteria21_contig00005578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00005578 (328 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551173.1| PREDICTED: U-box domain-containing protein 4... 63 8e-08 ref|XP_012571337.1| PREDICTED: U-box domain-containing protein 4... 62 2e-07 gb|KHN48396.1| U-box domain-containing protein 4 [Glycine soja] 59 1e-06 >ref|XP_003551173.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] gi|947048649|gb|KRG98177.1| hypothetical protein GLYMA_18G055200 [Glycine max] Length = 841 Score = 63.2 bits (152), Expect = 8e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 114 IGVMEISLLKRLVDSISSFLHLSFSGNMNSEPVSKY 7 +GVMEISLLK +V+ +SSFLHLSFSGNMNSEPVSKY Sbjct: 1 MGVMEISLLKMIVNGMSSFLHLSFSGNMNSEPVSKY 36 >ref|XP_012571337.1| PREDICTED: U-box domain-containing protein 4 [Cicer arietinum] Length = 833 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 105 MEISLLKRLVDSISSFLHLSFSGNMNSEPVSKY 7 MEISLLK L+D ISSFLHLSFSGNMNSEPVSKY Sbjct: 1 MEISLLKMLIDRISSFLHLSFSGNMNSEPVSKY 33 >gb|KHN48396.1| U-box domain-containing protein 4 [Glycine soja] Length = 838 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 105 MEISLLKRLVDSISSFLHLSFSGNMNSEPVSKY 7 MEISLLK +V+ +SSFLHLSFSGNMNSEPVSKY Sbjct: 1 MEISLLKMIVNGMSSFLHLSFSGNMNSEPVSKY 33