BLASTX nr result
ID: Wisteria21_contig00005548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00005548 (524 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH50598.1| hypothetical protein GLYMA_07G231000 [Glycine max] 57 5e-06 >gb|KRH50598.1| hypothetical protein GLYMA_07G231000 [Glycine max] Length = 126 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -3 Query: 519 LILSPHKNKARGHIERIMSRHRRQASQVMPPEILAGEDLTKPFDLNR 379 LI + K + H + MSRHRRQASQV+PPEILAGEDL K DL + Sbjct: 37 LISLSTQTKKQSHAHKNMSRHRRQASQVLPPEILAGEDLAKSLDLTQ 83