BLASTX nr result
ID: Wisteria21_contig00005500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00005500 (474 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014512625.1| PREDICTED: 40S ribosomal protein S28 [Vigna ... 86 1e-14 gb|KRH68063.1| hypothetical protein GLYMA_03G205800 [Glycine max] 85 2e-14 ref|XP_010099593.1| Nicotinamide mononucleotide adenylyltransfer... 85 2e-14 ref|XP_010055063.1| PREDICTED: 40S ribosomal protein S28-1-like ... 85 2e-14 gb|KCW71539.1| hypothetical protein EUGRSUZ_E00080, partial [Euc... 85 2e-14 ref|XP_003521522.1| PREDICTED: 40S ribosomal protein S28-like is... 85 2e-14 ref|XP_004489433.1| PREDICTED: 40S ribosomal protein S28 [Cicer ... 85 2e-14 ref|XP_007145744.1| hypothetical protein PHAVU_007G264100g [Phas... 84 3e-14 ref|XP_010105085.1| 40S ribosomal protein S28 [Morus notabilis] ... 84 5e-14 ref|XP_010093316.1| 40S ribosomal protein S28 [Morus notabilis] ... 84 5e-14 ref|XP_007163021.1| hypothetical protein PHAVU_001G199400g [Phas... 84 5e-14 ref|XP_006429965.1| hypothetical protein CICLE_v10013157mg [Citr... 83 7e-14 emb|CDP04901.1| unnamed protein product [Coffea canephora] 83 9e-14 gb|KGN53850.1| hypothetical protein Csa_4G166940 [Cucumis sativus] 82 1e-13 ref|XP_004138229.1| PREDICTED: 40S ribosomal protein S28-1 [Cucu... 82 1e-13 ref|XP_007202760.1| hypothetical protein PRUPE_ppa013411mg [Prun... 82 2e-13 ref|XP_010091561.1| 40S ribosomal protein S28 [Morus notabilis] ... 82 2e-13 ref|XP_007029134.1| Nucleic acid-binding, OB-fold-like protein [... 81 3e-13 emb|CBI29957.3| unnamed protein product [Vitis vinifera] 81 3e-13 gb|AEC10961.1| ribosomal protein s28 [Camellia sinensis] 81 3e-13 >ref|XP_014512625.1| PREDICTED: 40S ribosomal protein S28 [Vigna radiata var. radiata] gi|920690833|gb|KOM34058.1| hypothetical protein LR48_Vigan02g020800 [Vigna angularis] Length = 65 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV Sbjct: 1 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 42 >gb|KRH68063.1| hypothetical protein GLYMA_03G205800 [Glycine max] Length = 66 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 MESQVKHA+VVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV Sbjct: 2 MESQVKHALVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 43 >ref|XP_010099593.1| Nicotinamide mononucleotide adenylyltransferase 1 [Morus notabilis] gi|587891357|gb|EXB79987.1| Nicotinamide mononucleotide adenylyltransferase 1 [Morus notabilis] Length = 275 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -3 Query: 460 SANFRMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 S RMESQVKHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR IMRNV Sbjct: 206 STRVRMESQVKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNV 252 >ref|XP_010055063.1| PREDICTED: 40S ribosomal protein S28-1-like [Eucalyptus grandis] Length = 125 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 460 SANFRMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 +++ RM+SQ+KHA+VVKVMGRTGSRGQVTQVRVKFLDD NRHIMRNV Sbjct: 56 ASDLRMDSQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDMNRHIMRNV 102 >gb|KCW71539.1| hypothetical protein EUGRSUZ_E00080, partial [Eucalyptus grandis] Length = 97 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 460 SANFRMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 +++ RM+SQ+KHA+VVKVMGRTGSRGQVTQVRVKFLDD NRHIMRNV Sbjct: 28 ASDLRMDSQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDMNRHIMRNV 74 >ref|XP_003521522.1| PREDICTED: 40S ribosomal protein S28-like isoform X1 [Glycine max] gi|356549946|ref|XP_003543351.1| PREDICTED: 40S ribosomal protein S28 [Glycine max] gi|356572714|ref|XP_003554511.1| PREDICTED: 40S ribosomal protein S28-like isoform X1 [Glycine max] gi|571446492|ref|XP_006577108.1| PREDICTED: 40S ribosomal protein S28-like [Glycine max] gi|571446533|ref|XP_006577119.1| PREDICTED: 40S ribosomal protein S28-like isoform X2 [Glycine max] gi|571559237|ref|XP_006604678.1| PREDICTED: 40S ribosomal protein S28-like [Glycine max] gi|571559303|ref|XP_006604691.1| PREDICTED: 40S ribosomal protein S28-like isoform X2 [Glycine max] gi|571559307|ref|XP_006604692.1| PREDICTED: 40S ribosomal protein S28-like isoform X3 [Glycine max] gi|950950854|ref|XP_014495493.1| PREDICTED: 40S ribosomal protein S28-like [Vigna radiata var. radiata] gi|951072474|ref|XP_014491725.1| PREDICTED: 40S ribosomal protein S28-like [Vigna radiata var. radiata] gi|255628293|gb|ACU14491.1| unknown [Glycine max] gi|734379693|gb|KHN22575.1| 40S ribosomal protein S28 [Glycine soja] gi|734393557|gb|KHN28251.1| 40S ribosomal protein S28 [Glycine soja] gi|734413166|gb|KHN36611.1| 40S ribosomal protein S28 [Glycine soja] gi|734425889|gb|KHN43566.1| 40S ribosomal protein S28 [Glycine soja] gi|734425906|gb|KHN43583.1| 40S ribosomal protein S28 [Glycine soja] gi|920696316|gb|KOM39541.1| hypothetical protein LR48_Vigan03g292300 [Vigna angularis] gi|920700688|gb|KOM43913.1| hypothetical protein LR48_Vigan05g151800 [Vigna angularis] gi|947046699|gb|KRG96328.1| hypothetical protein GLYMA_19G203300 [Glycine max] gi|947046725|gb|KRG96354.1| hypothetical protein GLYMA_19G205100 [Glycine max] gi|947046726|gb|KRG96355.1| hypothetical protein GLYMA_19G205100 [Glycine max] gi|947073546|gb|KRH22437.1| hypothetical protein GLYMA_13G300200 [Glycine max] gi|947119839|gb|KRH68088.1| hypothetical protein GLYMA_03G207700 [Glycine max] Length = 65 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 MESQVKHA+VVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV Sbjct: 1 MESQVKHALVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 42 >ref|XP_004489433.1| PREDICTED: 40S ribosomal protein S28 [Cicer arietinum] gi|922348878|ref|XP_003618578.2| 40S ribosomal protein S28-1 [Medicago truncatula] gi|124359133|gb|ABD32492.2| Ribosomal protein S28e [Medicago truncatula] gi|388522463|gb|AFK49293.1| unknown [Medicago truncatula] gi|657380998|gb|AES74796.2| 40S ribosomal protein S28-1 [Medicago truncatula] Length = 65 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 MESQ+KHA+VVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV Sbjct: 1 MESQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 42 >ref|XP_007145744.1| hypothetical protein PHAVU_007G264100g [Phaseolus vulgaris] gi|561018934|gb|ESW17738.1| hypothetical protein PHAVU_007G264100g [Phaseolus vulgaris] Length = 65 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 M+SQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV Sbjct: 1 MDSQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 42 >ref|XP_010105085.1| 40S ribosomal protein S28 [Morus notabilis] gi|587916105|gb|EXC03823.1| 40S ribosomal protein S28 [Morus notabilis] Length = 155 Score = 83.6 bits (205), Expect = 5e-14 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 448 RMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 RMESQVKHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR IMRNV Sbjct: 90 RMESQVKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNV 132 >ref|XP_010093316.1| 40S ribosomal protein S28 [Morus notabilis] gi|587864162|gb|EXB53855.1| 40S ribosomal protein S28 [Morus notabilis] Length = 86 Score = 83.6 bits (205), Expect = 5e-14 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 448 RMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 RMESQVKHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR IMRNV Sbjct: 21 RMESQVKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNV 63 >ref|XP_007163021.1| hypothetical protein PHAVU_001G199400g [Phaseolus vulgaris] gi|561036485|gb|ESW35015.1| hypothetical protein PHAVU_001G199400g [Phaseolus vulgaris] Length = 65 Score = 83.6 bits (205), Expect = 5e-14 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 M+SQVKHA+VVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV Sbjct: 1 MDSQVKHALVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 42 >ref|XP_006429965.1| hypothetical protein CICLE_v10013157mg [Citrus clementina] gi|557532022|gb|ESR43205.1| hypothetical protein CICLE_v10013157mg [Citrus clementina] Length = 114 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 460 SANFRMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 +++ RM+SQ+KHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR IMRNV Sbjct: 45 ASSLRMDSQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNV 91 >emb|CDP04901.1| unnamed protein product [Coffea canephora] Length = 118 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 460 SANFRMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 SA RM+SQ+KHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR IMRNV Sbjct: 49 SAFDRMDSQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNV 95 >gb|KGN53850.1| hypothetical protein Csa_4G166940 [Cucumis sativus] Length = 314 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 MESQ+KHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR+IMRNV Sbjct: 1 MESQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRYIMRNV 42 >ref|XP_004138229.1| PREDICTED: 40S ribosomal protein S28-1 [Cucumis sativus] gi|659106538|ref|XP_008453373.1| PREDICTED: 40S ribosomal protein S28-1 [Cucumis melo] gi|659106541|ref|XP_008453374.1| PREDICTED: 40S ribosomal protein S28-1 [Cucumis melo] gi|659121665|ref|XP_008460765.1| PREDICTED: 40S ribosomal protein S28-1 [Cucumis melo] gi|778656299|ref|XP_011648782.1| PREDICTED: 40S ribosomal protein S28-1 [Cucumis sativus] gi|778692260|ref|XP_011653430.1| PREDICTED: 40S ribosomal protein S28-1 [Cucumis sativus] gi|700208706|gb|KGN63802.1| hypothetical protein Csa_1G021920 [Cucumis sativus] gi|700208707|gb|KGN63803.1| hypothetical protein Csa_1G021930 [Cucumis sativus] Length = 65 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 MESQ+KHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR+IMRNV Sbjct: 1 MESQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRYIMRNV 42 >ref|XP_007202760.1| hypothetical protein PRUPE_ppa013411mg [Prunus persica] gi|462398291|gb|EMJ03959.1| hypothetical protein PRUPE_ppa013411mg [Prunus persica] Length = 124 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = -3 Query: 463 PSANFRMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 P N RM+S +KHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR IMRNV Sbjct: 54 PLDNQRMDSTIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNV 101 >ref|XP_010091561.1| 40S ribosomal protein S28 [Morus notabilis] gi|587951197|gb|EXC37044.1| 40S ribosomal protein S28 [Morus notabilis] Length = 65 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 MESQVKHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR IMRNV Sbjct: 1 MESQVKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNV 42 >ref|XP_007029134.1| Nucleic acid-binding, OB-fold-like protein [Theobroma cacao] gi|508717739|gb|EOY09636.1| Nucleic acid-binding, OB-fold-like protein [Theobroma cacao] Length = 65 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 M+SQ+KHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR+IMRNV Sbjct: 1 MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRYIMRNV 42 >emb|CBI29957.3| unnamed protein product [Vitis vinifera] Length = 111 Score = 80.9 bits (198), Expect = 3e-13 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 460 SANFRMESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 S+ +MES VKHA+VVKVMGRTGSRGQVTQVRVKFLDDQNR IMRNV Sbjct: 42 SSQCKMESGVKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNV 88 >gb|AEC10961.1| ribosomal protein s28 [Camellia sinensis] Length = 65 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 445 MESQVKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRHIMRNV 320 MESQ+KHAIVVKVMGRTGSRGQVTQVRVKF+DDQNR IMRNV Sbjct: 1 MESQIKHAIVVKVMGRTGSRGQVTQVRVKFIDDQNRFIMRNV 42