BLASTX nr result
ID: Wisteria21_contig00005199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00005199 (221 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007143026.1| hypothetical protein PHAVU_007G037300g [Phas... 73 9e-11 gb|KHN06738.1| Putative fasciclin-like arabinogalactan protein 2... 72 2e-10 ref|XP_006589647.1| PREDICTED: putative fasciclin-like arabinoga... 72 2e-10 ref|XP_004496989.1| PREDICTED: putative fasciclin-like arabinoga... 72 2e-10 ref|XP_006605951.1| PREDICTED: putative fasciclin-like arabinoga... 71 4e-10 ref|XP_014511979.1| PREDICTED: putative fasciclin-like arabinoga... 68 3e-09 gb|KOM28889.1| hypothetical protein LR48_Vigan609s002100 [Vigna ... 68 3e-09 gb|KOM28888.1| hypothetical protein LR48_Vigan609s002000 [Vigna ... 68 3e-09 ref|XP_014511980.1| PREDICTED: putative fasciclin-like arabinoga... 66 9e-09 ref|XP_003592555.1| fasciclin-like arabinogalactan protein [Medi... 66 9e-09 >ref|XP_007143026.1| hypothetical protein PHAVU_007G037300g [Phaseolus vulgaris] gi|561016216|gb|ESW15020.1| hypothetical protein PHAVU_007G037300g [Phaseolus vulgaris] Length = 326 Score = 72.8 bits (177), Expect = 9e-11 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPREAIFDAADVLSDSGF+SMALTLE+VAETLLEQS SA Sbjct: 17 ALPREAIFDAADVLSDSGFVSMALTLEVVAETLLEQSPSA 56 >gb|KHN06738.1| Putative fasciclin-like arabinogalactan protein 20 [Glycine soja] Length = 343 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPREAIFDAADVLSDSG++SMALTLEIVAETLLEQS SA Sbjct: 22 ALPREAIFDAADVLSDSGYVSMALTLEIVAETLLEQSPSA 61 >ref|XP_006589647.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20-like [Glycine max] gi|947087079|gb|KRH35800.1| hypothetical protein GLYMA_10G265700 [Glycine max] Length = 339 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPREAIFDAADVLSDSG++SMALTLEIVAETLLEQS SA Sbjct: 22 ALPREAIFDAADVLSDSGYVSMALTLEIVAETLLEQSPSA 61 >ref|XP_004496989.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Cicer arietinum] Length = 342 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPREAIFDAADVLSDSGF+SM+LTLEIVAETLLEQS SA Sbjct: 22 ALPREAIFDAADVLSDSGFVSMSLTLEIVAETLLEQSPSA 61 >ref|XP_006605951.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20-like [Glycine max] gi|947041244|gb|KRG90968.1| hypothetical protein GLYMA_20G124900 [Glycine max] Length = 331 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPREAIFDA+DVLSDSG++SMALTLEIVAETLLEQS SA Sbjct: 22 ALPREAIFDASDVLSDSGYVSMALTLEIVAETLLEQSPSA 61 >ref|XP_014511979.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Vigna radiata var. radiata] Length = 327 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPREA+FDAADVL DSGF+SMALTLE+VAE LLEQS SA Sbjct: 20 ALPREAVFDAADVLLDSGFVSMALTLEVVAERLLEQSPSA 59 >gb|KOM28889.1| hypothetical protein LR48_Vigan609s002100 [Vigna angularis] Length = 328 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPREA+FDAADVL DSGF+SMALTLE+VAE LLEQS SA Sbjct: 22 ALPREAVFDAADVLLDSGFVSMALTLEVVAERLLEQSPSA 61 >gb|KOM28888.1| hypothetical protein LR48_Vigan609s002000 [Vigna angularis] Length = 328 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPREA+FDAADVL DSGF+SMALTLE+VAE LLEQS SA Sbjct: 22 ALPREAVFDAADVLLDSGFVSMALTLEVVAERLLEQSPSA 61 >ref|XP_014511980.1| PREDICTED: putative fasciclin-like arabinogalactan protein 20 [Vigna radiata var. radiata] Length = 331 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPRE +FDAADVL DSGF+SMALTLE+VAE LLEQS SA Sbjct: 22 ALPREVVFDAADVLLDSGFVSMALTLEVVAERLLEQSPSA 61 >ref|XP_003592555.1| fasciclin-like arabinogalactan protein [Medicago truncatula] gi|355481603|gb|AES62806.1| fasciclin-like arabinogalactan protein [Medicago truncatula] Length = 340 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -2 Query: 121 ALPREAIFDAADVLSDSGFISMALTLEIVAETLLEQSSSA 2 ALPRE IFDAAD+L DSGF+SM+LTLEIVAE+LLEQS SA Sbjct: 22 ALPRETIFDAADILLDSGFVSMSLTLEIVAESLLEQSHSA 61