BLASTX nr result
ID: Wisteria21_contig00003430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00003430 (347 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014501330.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 78 2e-12 ref|XP_006578149.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 78 2e-12 ref|XP_007137031.1| hypothetical protein PHAVU_009G093800g [Phas... 78 2e-12 gb|AGV54745.1| DEAD-box ATP-dependent RNA helicase 56-like prote... 78 2e-12 gb|AGV54235.1| DEAD-box ATP-dependent RNA helicase 56 [Phaseolus... 78 2e-12 ref|XP_003522620.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 78 2e-12 ref|XP_003526412.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 78 2e-12 gb|ACU23716.1| unknown [Glycine max] 78 2e-12 ref|XP_012571643.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 77 7e-12 ref|XP_012570767.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 77 7e-12 ref|XP_004498731.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 77 7e-12 gb|AFV30230.1| ATP-dependent RNA helicase [Medicago sativa] 77 7e-12 gb|AFK41905.1| unknown [Medicago truncatula] 77 7e-12 ref|XP_003588757.1| DEAD-box ATP-dependent RNA helicase-like pro... 77 7e-12 ref|XP_003603412.1| DEAD-box ATP-dependent RNA helicase-like pro... 76 9e-12 ref|XP_014505368.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 75 1e-11 ref|XP_007161216.1| hypothetical protein PHAVU_001G051700g [Phas... 75 1e-11 gb|KOM41983.1| hypothetical protein LR48_Vigan04g218100 [Vigna a... 72 2e-10 gb|KOM27754.1| hypothetical protein LR48_Vigan462s000700 [Vigna ... 69 1e-09 ref|XP_008445205.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 69 2e-09 >ref|XP_014501330.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vigna radiata var. radiata] gi|950976659|ref|XP_014501331.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vigna radiata var. radiata] Length = 427 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >ref|XP_006578149.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Glycine max] Length = 344 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 307 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 344 >ref|XP_007137031.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris] gi|561010118|gb|ESW09025.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris] Length = 427 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >gb|AGV54745.1| DEAD-box ATP-dependent RNA helicase 56-like protein [Phaseolus vulgaris] Length = 427 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >gb|AGV54235.1| DEAD-box ATP-dependent RNA helicase 56 [Phaseolus vulgaris] Length = 427 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >ref|XP_003522620.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Glycine max] gi|734336046|gb|KHN08125.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja] gi|947113481|gb|KRH61783.1| hypothetical protein GLYMA_04G067600 [Glycine max] gi|947113482|gb|KRH61784.1| hypothetical protein GLYMA_04G067600 [Glycine max] Length = 427 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >ref|XP_003526412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX1 [Glycine max] gi|356515450|ref|XP_003526413.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX2 [Glycine max] gi|571459271|ref|XP_006581360.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X3 [Glycine max] gi|734331486|gb|KHN07085.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja] gi|947104069|gb|KRH52452.1| hypothetical protein GLYMA_06G069200 [Glycine max] gi|947104070|gb|KRH52453.1| hypothetical protein GLYMA_06G069200 [Glycine max] gi|947104071|gb|KRH52454.1| hypothetical protein GLYMA_06G069200 [Glycine max] Length = 427 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >gb|ACU23716.1| unknown [Glycine max] Length = 226 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 189 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 226 >ref|XP_012571643.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Cicer arietinum] Length = 427 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC++DVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSSDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >ref|XP_012570767.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Cicer arietinum] Length = 344 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC++DVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 307 TFVSCSSDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 344 >ref|XP_004498731.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X1 [Cicer arietinum] Length = 427 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC++DVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSSDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >gb|AFV30230.1| ATP-dependent RNA helicase [Medicago sativa] Length = 427 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC++DVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSSDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >gb|AFK41905.1| unknown [Medicago truncatula] Length = 427 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC++DVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSSDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >ref|XP_003588757.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula] gi|355477805|gb|AES59008.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula] Length = 427 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC++DVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSSDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 427 >ref|XP_003603412.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula] gi|355492460|gb|AES73663.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula] Length = 427 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC++DVDVLNNVQSRFE+DIKQLPEQIDTSTYMPS Sbjct: 390 TFVSCSSDVDVLNNVQSRFEIDIKQLPEQIDTSTYMPS 427 >ref|XP_014505368.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Vigna radiata var. radiata] Length = 426 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDT++YMPS Sbjct: 389 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTASYMPS 426 >ref|XP_007161216.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris] gi|561034680|gb|ESW33210.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris] Length = 426 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDT++YMPS Sbjct: 389 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTASYMPS 426 >gb|KOM41983.1| hypothetical protein LR48_Vigan04g218100 [Vigna angularis] Length = 477 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTY 241 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDTSTY Sbjct: 407 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTY 441 >gb|KOM27754.1| hypothetical protein LR48_Vigan462s000700 [Vigna angularis] Length = 430 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTY 241 TFVSC+TDVDVLNNVQSRFEVDIKQLPEQIDT++Y Sbjct: 389 TFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTASY 423 >ref|XP_008445205.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo] gi|659088872|ref|XP_008445206.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo] gi|778672512|ref|XP_004138728.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis sativus] gi|778672515|ref|XP_011649821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis sativus] gi|700207827|gb|KGN62946.1| hypothetical protein Csa_2G381720 [Cucumis sativus] Length = 427 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 345 TFVSCATDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS 232 TFVS A D DVLNNVQ RFEVDIK+LPEQIDTSTYMPS Sbjct: 390 TFVSSAADSDVLNNVQERFEVDIKELPEQIDTSTYMPS 427