BLASTX nr result
ID: Wisteria21_contig00001622
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00001622 (208 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012570162.1| PREDICTED: low-temperature-induced 65 kDa pr... 56 9e-06 >ref|XP_012570162.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform X1 [Cicer arietinum] gi|828305365|ref|XP_012570163.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform X2 [Cicer arietinum] gi|828305367|ref|XP_012570164.1| PREDICTED: low-temperature-induced 65 kDa protein-like isoform X3 [Cicer arietinum] Length = 505 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 207 DKIEDIASVEESFERTNVHDERKPTQEQEIQPTGANTEYPSAEA 76 D+I+DI +EES ER NVHDE KPT E +IQP+ A+TEY A A Sbjct: 216 DEIKDITPLEESLERLNVHDEPKPTTEPKIQPSVADTEYSPAAA 259