BLASTX nr result
ID: Wisteria21_contig00000703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00000703 (552 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH35688.1| hypothetical protein GLYMA_10G258500 [Glycine max] 63 1e-07 gb|ACG30830.1| 40S ribosomal protein S29 [Zea mays] 61 3e-07 gb|KNA05754.1| hypothetical protein SOVF_187480 [Spinacia olerac... 59 1e-06 gb|KMZ56715.1| 40S ribosomal protein S29 [Zostera marina] gi|901... 59 1e-06 ref|XP_010099604.1| 40S ribosomal protein S29 [Morus notabilis] ... 59 1e-06 ref|XP_011078121.1| PREDICTED: 40S ribosomal protein S29 [Sesamu... 59 1e-06 ref|XP_010679081.1| PREDICTED: 40S ribosomal protein S29 [Beta v... 59 1e-06 gb|KHG00104.1| 40S ribosomal S29 -like protein [Gossypium arboreum] 59 1e-06 ref|XP_010272246.1| PREDICTED: 40S ribosomal protein S29 [Nelumb... 59 1e-06 ref|XP_010061691.1| PREDICTED: 40S ribosomal protein S29 [Eucaly... 59 1e-06 ref|XP_009393841.1| PREDICTED: 40S ribosomal protein S29 [Musa a... 59 1e-06 emb|CDO97266.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDO97835.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_008390572.1| PREDICTED: 40S ribosomal protein S29-like [M... 59 1e-06 gb|KCW68667.1| hypothetical protein EUGRSUZ_F02264, partial [Euc... 59 1e-06 gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] 59 1e-06 ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29 [Vitis ... 59 1e-06 ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [V... 59 1e-06 ref|NP_001294917.1| uncharacterized protein LOC544138 [Solanum l... 59 1e-06 ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29 [Cicer ... 59 1e-06 >gb|KRH35688.1| hypothetical protein GLYMA_10G258500 [Glycine max] Length = 103 Score = 62.8 bits (151), Expect = 1e-07 Identities = 38/72 (52%), Positives = 40/72 (55%), Gaps = 20/72 (27%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR*RVNCHL--------------------PSQF*VLA 432 RKYGLMCCRQCFRSNAKEIGFIK V + Q+ VLA Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKVHLNVLFLIFVFELVQFEFTLSLKELLSPTDQYYVLA 91 Query: 431 LG*CEDVMFEET 396 LG EDVMFEET Sbjct: 92 LGCFEDVMFEET 103 >gb|ACG30830.1| 40S ribosomal protein S29 [Zea mays] Length = 99 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR*RVNCHLPSQF 444 RKYGLMCCRQCFRSNAK+IGFIKYR R +C F Sbjct: 32 RKYGLMCCRQCFRSNAKDIGFIKYRWRGHCAAVENF 67 >gb|KNA05754.1| hypothetical protein SOVF_187480 [Spinacia oleracea] gi|902228681|gb|KNA21216.1| hypothetical protein SOVF_044700 [Spinacia oleracea] gi|902235102|gb|KNA23766.1| hypothetical protein SOVF_022300 [Spinacia oleracea] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|KMZ56715.1| 40S ribosomal protein S29 [Zostera marina] gi|901801493|gb|KMZ61439.1| 40S ribosomal protein S29 [Zostera marina] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_010099604.1| 40S ribosomal protein S29 [Morus notabilis] gi|587891408|gb|EXB80035.1| 40S ribosomal protein S29 [Morus notabilis] Length = 82 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 58 RKYGLMCCRQCFRSNAKEIGFIKYR 82 >ref|XP_011078121.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747081556|ref|XP_011088056.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747089732|ref|XP_011092516.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747092208|ref|XP_011093855.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_010679081.1| PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] gi|731336113|ref|XP_010679083.1| PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] gi|731340623|ref|XP_010681497.1| PREDICTED: 40S ribosomal protein S29 [Beta vulgaris subsp. vulgaris] gi|870856737|gb|KMT08336.1| hypothetical protein BVRB_6g141600 [Beta vulgaris subsp. vulgaris] gi|870858710|gb|KMT10198.1| hypothetical protein BVRB_5g119590 [Beta vulgaris subsp. vulgaris] gi|870858711|gb|KMT10199.1| hypothetical protein BVRB_5g119600 [Beta vulgaris subsp. vulgaris] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >gb|KHG00104.1| 40S ribosomal S29 -like protein [Gossypium arboreum] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_010272246.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|720018519|ref|XP_010261813.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|720068354|ref|XP_010277082.1| PREDICTED: 40S ribosomal protein S29 [Nelumbo nucifera] gi|802550661|ref|XP_012093101.1| PREDICTED: 40S ribosomal protein S29 [Jatropha curcas] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_010061691.1| PREDICTED: 40S ribosomal protein S29 [Eucalyptus grandis] gi|702462264|ref|XP_010028373.1| PREDICTED: 40S ribosomal protein S29 [Eucalyptus grandis] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_009393841.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695034633|ref|XP_009404780.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695065043|ref|XP_009421099.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] gi|695078263|ref|XP_009386513.1| PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >emb|CDO97266.1| unnamed protein product [Coffea canephora] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >emb|CDO97835.1| unnamed protein product [Coffea canephora] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_008390572.1| PREDICTED: 40S ribosomal protein S29-like [Malus domestica] Length = 65 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 41 RKYGLMCCRQCFRSNAKEIGFIKYR 65 >gb|KCW68667.1| hypothetical protein EUGRSUZ_F02264, partial [Eucalyptus grandis] Length = 83 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 59 RKYGLMCCRQCFRSNAKEIGFIKYR 83 >gb|ADB02896.1| ribosomal protein S29 [Jatropha curcas] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] gi|470106904|ref|XP_004289795.1| PREDICTED: 40S ribosomal protein S29 [Fragaria vesca subsp. vesca] gi|470109340|ref|XP_004290957.1| PREDICTED: 40S ribosomal protein S29 [Fragaria vesca subsp. vesca] gi|593640056|ref|XP_007143103.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] gi|561016293|gb|ESW15097.1| hypothetical protein PHAVU_007G043800g [Phaseolus vulgaris] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|225444692|ref|XP_002277856.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] gi|255538096|ref|XP_002510113.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|356497504|ref|XP_003517600.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|356536119|ref|XP_003536587.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356538933|ref|XP_003537955.1| PREDICTED: 40S ribosomal protein S29-like isoform 1 [Glycine max] gi|356575720|ref|XP_003555985.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|449438331|ref|XP_004136942.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|449447053|ref|XP_004141284.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|449469128|ref|XP_004152273.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|645261744|ref|XP_008236441.1| PREDICTED: 40S ribosomal protein S29 [Prunus mume] gi|657962892|ref|XP_008373047.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] gi|658061279|ref|XP_008366503.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] gi|659103501|ref|XP_008452633.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|659108782|ref|XP_008454386.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|659110059|ref|XP_008455027.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|694414331|ref|XP_009335389.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414333|ref|XP_009335391.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414343|ref|XP_009335395.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414345|ref|XP_009335396.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|802570598|ref|XP_012068241.1| PREDICTED: 40S ribosomal protein S29-like [Jatropha curcas] gi|951021513|ref|XP_014512686.1| PREDICTED: 40S ribosomal protein S29 [Vigna radiata var. radiata] gi|951050510|ref|XP_014520214.1| PREDICTED: 40S ribosomal protein S29 [Vigna radiata var. radiata] gi|223550814|gb|EEF52300.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|700200099|gb|KGN55257.1| 40S ribosomal protein S29 [Cucumis sativus] gi|734330582|gb|KHN06796.1| 40S ribosomal protein S29 [Glycine soja] gi|734423705|gb|KHN42324.1| 40S ribosomal protein S29 [Glycine soja] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|NP_001294917.1| uncharacterized protein LOC544138 [Solanum lycopersicum] gi|565361057|ref|XP_006347277.1| PREDICTED: 40S ribosomal protein S29-like [Solanum tuberosum] gi|565367342|ref|XP_006350329.1| PREDICTED: 40S ribosomal protein S29-like [Solanum tuberosum] gi|697144498|ref|XP_009626362.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana tomentosiformis] gi|697166313|ref|XP_009591987.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana tomentosiformis] gi|698526017|ref|XP_009759838.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana sylvestris] gi|698575940|ref|XP_009776080.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana sylvestris] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56 >ref|XP_004491390.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] gi|502158873|ref|XP_004511309.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] gi|828305776|ref|XP_012570209.1| PREDICTED: 40S ribosomal protein S29 [Cicer arietinum] Length = 56 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 551 RKYGLMCCRQCFRSNAKEIGFIKYR 477 RKYGLMCCRQCFRSNAKEIGFIKYR Sbjct: 32 RKYGLMCCRQCFRSNAKEIGFIKYR 56