BLASTX nr result
ID: Stemona21_contig00045801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00045801 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65978.1| hypothetical protein [Beta vulgaris subsp. vulga... 60 3e-07 >emb|CCA65978.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 428 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/67 (34%), Positives = 43/67 (64%) Frame = -3 Query: 201 DGKRIAKCPKEAVDRALKSWEHTIVGYVMEKTPSYLAMKRFVEKSWKTKGEVKILKRDNG 22 +G+ +AK K+ VDRA + W++ ++ YV+ + PS +A+ ++ + W K E KI K + G Sbjct: 102 NGENVAKLDKKEVDRATEEWQNALIVYVIGQNPSLMAITKYCKSQWAPKTEPKIFKHEEG 161 Query: 21 FFIFQFE 1 +F+ + E Sbjct: 162 YFVVKME 168