BLASTX nr result
ID: Stemona21_contig00045437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00045437 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002720156.1| ORF126 [Jatropha curcas] gi|225544183|ref|YP... 62 8e-08 >ref|YP_002720156.1| ORF126 [Jatropha curcas] gi|225544183|ref|YP_002720173.1| ORF126 [Jatropha curcas] gi|224979608|gb|ACN72735.1| ORF126 [Jatropha curcas] gi|224979624|gb|ACN72751.1| ORF126 [Jatropha curcas] Length = 126 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/50 (68%), Positives = 36/50 (72%) Frame = +3 Query: 246 KTSCKIPTSTRNPTDKVHYIVCLYIVRLYIVRFRDWRLTHSVTLALDVPK 395 +TS K+P RNPTDKVHYIV RFRDWRLTHSVTLALDVPK Sbjct: 32 ETSGKMPA--RNPTDKVHYIV----------RFRDWRLTHSVTLALDVPK 69