BLASTX nr result
ID: Stemona21_contig00044019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00044019 (477 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS63941.1| hypothetical protein TRIUR3_25948 [Triticum urartu] 106 4e-21 gb|AFW85258.1| hypothetical protein ZEAMMB73_606432 [Zea mays] g... 104 1e-20 ref|NP_001169361.1| uncharacterized protein LOC100383228 [Zea ma... 104 1e-20 gb|EMT07364.1| Pentatricopeptide repeat-containing protein [Aegi... 103 2e-20 ref|XP_004966826.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_002438098.1| hypothetical protein SORBIDRAFT_10g007970 [S... 103 2e-20 gb|ACL79586.1| pentatricopeptide repeat protein [Oryza sativa Ja... 103 2e-20 gb|ACL79585.1| pentatricopeptide repeat protein [Oryza sativa Ja... 103 2e-20 gb|EEC78775.1| hypothetical protein OsI_19008 [Oryza sativa Indi... 103 2e-20 ref|XP_006656800.1| PREDICTED: pentatricopeptide repeat-containi... 101 9e-20 dbj|BAJ89270.1| predicted protein [Hordeum vulgare subsp. vulgare] 101 9e-20 ref|XP_003564056.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 gb|ABA97375.1| pentatricopeptide, putative, expressed [Oryza sat... 99 4e-19 gb|EEE62865.1| hypothetical protein OsJ_17668 [Oryza sativa Japo... 99 4e-19 gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis] 98 1e-18 emb|CBI28351.3| unnamed protein product [Vitis vinifera] 98 1e-18 ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_006480615.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_006428806.1| hypothetical protein CICLE_v10011151mg [Citr... 97 2e-18 ref|XP_006349117.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 >gb|EMS63941.1| hypothetical protein TRIUR3_25948 [Triticum urartu] Length = 482 Score = 106 bits (264), Expect = 4e-21 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP ++VIKNLRICGDCH VAKL+SKAY RVI+IRDRARFHRFE G CSCGDYW Sbjct: 425 IATPPGETLRVIKNLRICGDCHVVAKLISKAYGRVIIIRDRARFHRFEDGQCSCGDYW 482 >gb|AFW85258.1| hypothetical protein ZEAMMB73_606432 [Zea mays] gi|413952610|gb|AFW85259.1| hypothetical protein ZEAMMB73_606432 [Zea mays] gi|413952611|gb|AFW85260.1| hypothetical protein ZEAMMB73_606432 [Zea mays] Length = 630 Score = 104 bits (259), Expect = 1e-20 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 +STPP I+VIKNLR CGDCH VAKL+SKAY RVI+IRDRARFHRFE G+CSC DYW Sbjct: 573 ISTPPGETIRVIKNLRTCGDCHVVAKLISKAYNRVIIIRDRARFHRFEDGHCSCRDYW 630 >ref|NP_001169361.1| uncharacterized protein LOC100383228 [Zea mays] gi|224028917|gb|ACN33534.1| unknown [Zea mays] Length = 596 Score = 104 bits (259), Expect = 1e-20 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 +STPP I+VIKNLR CGDCH VAKL+SKAY RVI+IRDRARFHRFE G+CSC DYW Sbjct: 539 ISTPPGETIRVIKNLRTCGDCHVVAKLISKAYNRVIIIRDRARFHRFEDGHCSCRDYW 596 >gb|EMT07364.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii] Length = 454 Score = 103 bits (258), Expect = 2e-20 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP ++VIKNLRICGDCH VAKL+SKAY RVI+IRDRARFHRFE G CSC DYW Sbjct: 359 IATPPGETLRVIKNLRICGDCHVVAKLISKAYGRVIIIRDRARFHRFEDGQCSCSDYW 416 >ref|XP_004966826.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Setaria italica] Length = 598 Score = 103 bits (257), Expect = 2e-20 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 +STPP I+VIKNLRICGDCH VAKL+SK Y RVI+IRDRARFHRFE G CSC DYW Sbjct: 541 ISTPPGETIRVIKNLRICGDCHVVAKLISKVYGRVIIIRDRARFHRFEDGQCSCRDYW 598 >ref|XP_002438098.1| hypothetical protein SORBIDRAFT_10g007970 [Sorghum bicolor] gi|241916321|gb|EER89465.1| hypothetical protein SORBIDRAFT_10g007970 [Sorghum bicolor] Length = 596 Score = 103 bits (257), Expect = 2e-20 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 +STPP I+VIKNLRICGDCH VAKL+SKAY RVI+IRDRARFH+FE G CSC DYW Sbjct: 539 ISTPPGETIRVIKNLRICGDCHVVAKLISKAYGRVIIIRDRARFHQFEDGQCSCRDYW 596 >gb|ACL79586.1| pentatricopeptide repeat protein [Oryza sativa Japonica Group] Length = 587 Score = 103 bits (257), Expect = 2e-20 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP ++VIKNLRICGDCH VAKL+SKAY RVIVIRDRARFHRFE G CSC DYW Sbjct: 530 IATPPGETLRVIKNLRICGDCHVVAKLISKAYGRVIVIRDRARFHRFEDGQCSCRDYW 587 >gb|ACL79585.1| pentatricopeptide repeat protein [Oryza sativa Japonica Group] Length = 589 Score = 103 bits (257), Expect = 2e-20 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP ++VIKNLRICGDCH VAKL+SKAY RVIVIRDRARFHRFE G CSC DYW Sbjct: 532 IATPPGETLRVIKNLRICGDCHVVAKLISKAYGRVIVIRDRARFHRFEDGQCSCRDYW 589 >gb|EEC78775.1| hypothetical protein OsI_19008 [Oryza sativa Indica Group] Length = 580 Score = 103 bits (257), Expect = 2e-20 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP ++VIKNLRICGDCH VAKL+SKAY RVIVIRDRARFHRFE G CSC DYW Sbjct: 523 IATPPGETLRVIKNLRICGDCHVVAKLISKAYGRVIVIRDRARFHRFEDGQCSCRDYW 580 >ref|XP_006656800.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Oryza brachyantha] Length = 554 Score = 101 bits (252), Expect = 9e-20 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP ++VIKNLRICGDCH VAKL+SKAY RVI+IRDRARFH+FE G CSC DYW Sbjct: 497 IATPPGETLRVIKNLRICGDCHVVAKLISKAYGRVIIIRDRARFHQFEDGECSCKDYW 554 >dbj|BAJ89270.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 580 Score = 101 bits (252), Expect = 9e-20 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP ++VIKN+RICGDCH VAKL+SKAY R I+IRDRARFHRFE G CSC DYW Sbjct: 523 IATPPGETLRVIKNIRICGDCHVVAKLISKAYGRAIIIRDRARFHRFEDGQCSCSDYW 580 >ref|XP_003564056.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Brachypodium distachyon] Length = 594 Score = 99.8 bits (247), Expect = 3e-19 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP ++VIKNLR CGDCH VAKL+SKAY RVI+IRDRARFH+FE G CSC DYW Sbjct: 537 IATPPGETLRVIKNLRTCGDCHVVAKLISKAYGRVIIIRDRARFHQFEDGQCSCKDYW 594 >gb|ABA97375.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] Length = 794 Score = 99.4 bits (246), Expect = 4e-19 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDY 307 ++TPP ++VIKNLRICGDCH VAKL+SKAY RVIVIRDRARFHRFE G CSC DY Sbjct: 530 IATPPGETLRVIKNLRICGDCHVVAKLISKAYGRVIVIRDRARFHRFEDGQCSCRDY 586 >gb|EEE62865.1| hypothetical protein OsJ_17668 [Oryza sativa Japonica Group] Length = 620 Score = 99.4 bits (246), Expect = 4e-19 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDY 307 ++TPP ++VIKNLRICGDCH VAKL+SKAY RVIVIRDRARFHRFE G CSC DY Sbjct: 359 IATPPGETLRVIKNLRICGDCHVVAKLISKAYGRVIVIRDRARFHRFEDGQCSCRDY 415 >gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis] Length = 739 Score = 98.2 bits (243), Expect = 1e-18 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 +ST PS PI+V+KNLR+CGDCH VAKLVSK Y+R I++RDR RFH F+ G+CSCG+YW Sbjct: 682 ISTAPSQPIRVVKNLRVCGDCHAVAKLVSKVYKREILLRDRYRFHHFKDGHCSCGEYW 739 >emb|CBI28351.3| unnamed protein product [Vitis vinifera] Length = 770 Score = 97.8 bits (242), Expect = 1e-18 Identities = 39/58 (67%), Positives = 48/58 (82%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP PIQ++KNLR+CGDCHTV KL+SK R IV+RD RFH F+GG+CSCGDYW Sbjct: 713 IATPPGTPIQIVKNLRVCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 770 >ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Vitis vinifera] Length = 866 Score = 97.8 bits (242), Expect = 1e-18 Identities = 39/58 (67%), Positives = 48/58 (82%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP PIQ++KNLR+CGDCHTV KL+SK R IV+RD RFH F+GG+CSCGDYW Sbjct: 809 IATPPGTPIQIVKNLRVCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 866 >ref|XP_006480615.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Citrus sinensis] Length = 746 Score = 97.4 bits (241), Expect = 2e-18 Identities = 39/58 (67%), Positives = 48/58 (82%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 +S PS PI+++KNLR+CGDCH+VAKL+SK Y R I++RDR RFH F GGNCSC DYW Sbjct: 689 ISVEPSQPIRIVKNLRVCGDCHSVAKLISKLYNREILLRDRYRFHHFSGGNCSCMDYW 746 >ref|XP_006428806.1| hypothetical protein CICLE_v10011151mg [Citrus clementina] gi|557530863|gb|ESR42046.1| hypothetical protein CICLE_v10011151mg [Citrus clementina] Length = 737 Score = 97.4 bits (241), Expect = 2e-18 Identities = 39/58 (67%), Positives = 48/58 (82%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 +S PS PI+++KNLR+CGDCH+VAKL+SK Y R I++RDR RFH F GGNCSC DYW Sbjct: 680 ISVEPSQPIRIVKNLRVCGDCHSVAKLISKLYNREILLRDRYRFHHFSGGNCSCMDYW 737 >ref|XP_006349117.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Solanum tuberosum] Length = 871 Score = 96.3 bits (238), Expect = 4e-18 Identities = 39/58 (67%), Positives = 47/58 (81%) Frame = -1 Query: 477 VSTPPSAPIQVIKNLRICGDCHTVAKLVSKAYQRVIVIRDRARFHRFEGGNCSCGDYW 304 ++TPP PIQ++KNLR+CGDCHTV KL+SK R IV+RD RFH F+GG CSCGDYW Sbjct: 814 IATPPGIPIQIVKNLRVCGDCHTVIKLISKIEGRQIVVRDSNRFHHFKGGLCSCGDYW 871