BLASTX nr result
ID: Stemona21_contig00043905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00043905 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS49148.1| hypothetical protein TRIUR3_14403 [Triticum urartu] 93 4e-17 ref|XP_003572243.1| PREDICTED: pentatricopeptide repeat-containi... 92 7e-17 ref|XP_002445550.1| hypothetical protein SORBIDRAFT_07g021340 [S... 92 7e-17 ref|XP_006477459.1| PREDICTED: pentatricopeptide repeat-containi... 92 9e-17 ref|XP_006440604.1| hypothetical protein CICLE_v10018999mg [Citr... 92 9e-17 ref|NP_001061876.1| Os08g0434000 [Oryza sativa Japonica Group] g... 90 4e-16 emb|CBI15219.3| unnamed protein product [Vitis vinifera] 90 4e-16 ref|XP_002282049.1| PREDICTED: pentatricopeptide repeat-containi... 90 4e-16 gb|EAZ07094.1| hypothetical protein OsI_29343 [Oryza sativa Indi... 90 4e-16 gb|EXB44694.1| hypothetical protein L484_015951 [Morus notabilis] 89 6e-16 ref|XP_006659434.1| PREDICTED: pentatricopeptide repeat-containi... 89 6e-16 ref|XP_004235997.1| PREDICTED: pentatricopeptide repeat-containi... 89 6e-16 ref|XP_006364594.1| PREDICTED: pentatricopeptide repeat-containi... 89 8e-16 ref|XP_004301147.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 tpg|DAA48971.1| TPA: selenium-binding protein-like protein [Zea ... 88 1e-15 ref|NP_001148047.1| LOC100281656 [Zea mays] gi|195615502|gb|ACG2... 88 1e-15 gb|EMJ11463.1| hypothetical protein PRUPE_ppa003212mg [Prunus pe... 88 1e-15 gb|EOY21867.1| Pentatricopeptide repeat superfamily protein isof... 87 2e-15 ref|XP_004155062.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_004974732.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 87 3e-15 >gb|EMS49148.1| hypothetical protein TRIUR3_14403 [Triticum urartu] Length = 483 Score = 92.8 bits (229), Expect = 4e-17 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F KV S VYNRL+IVRDR+RFHHF+ GQCSCNDYW Sbjct: 437 AKNLRVCVDCHNFTKVFSGVYNRLVIVRDRTRFHHFEGGQCSCNDYW 483 >ref|XP_003572243.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Brachypodium distachyon] Length = 884 Score = 92.0 bits (227), Expect = 7e-17 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F KV S VYNRL+IVRDR+RFHHF GQCSCNDYW Sbjct: 838 AKNLRVCVDCHNFTKVFSGVYNRLVIVRDRTRFHHFNGGQCSCNDYW 884 >ref|XP_002445550.1| hypothetical protein SORBIDRAFT_07g021340 [Sorghum bicolor] gi|241941900|gb|EES15045.1| hypothetical protein SORBIDRAFT_07g021340 [Sorghum bicolor] Length = 595 Score = 92.0 bits (227), Expect = 7e-17 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F KV S +YNRL+IVRDR+RFHHFQ G+CSCNDYW Sbjct: 549 AKNLRVCVDCHNFTKVFSGIYNRLVIVRDRTRFHHFQGGKCSCNDYW 595 >ref|XP_006477459.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Citrus sinensis] Length = 580 Score = 91.7 bits (226), Expect = 9e-17 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLRICVDCH F KVLS VYNR +I+RDR RFHHF+EG+CSCNDYW Sbjct: 534 AKNLRICVDCHNFAKVLSGVYNREVIIRDRLRFHHFREGRCSCNDYW 580 >ref|XP_006440604.1| hypothetical protein CICLE_v10018999mg [Citrus clementina] gi|557542866|gb|ESR53844.1| hypothetical protein CICLE_v10018999mg [Citrus clementina] Length = 745 Score = 91.7 bits (226), Expect = 9e-17 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLRICVDCH F KVLS VYNR +I+RDR RFHHF+EG+CSCNDYW Sbjct: 699 AKNLRICVDCHNFAKVLSGVYNREVIIRDRLRFHHFREGRCSCNDYW 745 >ref|NP_001061876.1| Os08g0434000 [Oryza sativa Japonica Group] gi|42407498|dbj|BAD10615.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|42409483|dbj|BAD09839.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|113623845|dbj|BAF23790.1| Os08g0434000 [Oryza sativa Japonica Group] Length = 601 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F KV S VY+RL+IVRDR+RFHHF+E QCSCNDYW Sbjct: 555 AKNLRVCVDCHNFTKVFSGVYHRLVIVRDRTRFHHFKEFQCSCNDYW 601 >emb|CBI15219.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 89.7 bits (221), Expect = 4e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLRICVDCH F KVLS YNR +++RDR+RFHHF+EGQCSCN YW Sbjct: 451 AKNLRICVDCHNFAKVLSGAYNREVVIRDRTRFHHFREGQCSCNGYW 497 >ref|XP_002282049.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Vitis vinifera] Length = 643 Score = 89.7 bits (221), Expect = 4e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLRICVDCH F KVLS YNR +++RDR+RFHHF+EGQCSCN YW Sbjct: 597 AKNLRICVDCHNFAKVLSGAYNREVVIRDRTRFHHFREGQCSCNGYW 643 >gb|EAZ07094.1| hypothetical protein OsI_29343 [Oryza sativa Indica Group] Length = 378 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F KV S VY+RL+IVRDR+RFHHF+E QCSCNDYW Sbjct: 332 AKNLRVCVDCHNFTKVFSGVYHRLVIVRDRTRFHHFKEFQCSCNDYW 378 >gb|EXB44694.1| hypothetical protein L484_015951 [Morus notabilis] Length = 640 Score = 89.0 bits (219), Expect = 6e-16 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKN+R CVDCH F KVLS VYNR +++RDR+RFHHF EG+CSCNDYW Sbjct: 594 AKNIRTCVDCHNFAKVLSGVYNRQVVIRDRTRFHHFLEGRCSCNDYW 640 >ref|XP_006659434.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Oryza brachyantha] Length = 595 Score = 89.0 bits (219), Expect = 6e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F KV S VYNRL+IVRDR+RFHHF+ QCSCNDYW Sbjct: 549 AKNLRVCVDCHNFTKVFSGVYNRLVIVRDRTRFHHFKGFQCSCNDYW 595 >ref|XP_004235997.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Solanum lycopersicum] Length = 621 Score = 89.0 bits (219), Expect = 6e-16 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AK+LRICVDCH F K+LS+VY+R +I+RDR+RFHHF+EG+CSCNDYW Sbjct: 575 AKDLRICVDCHNFAKILSAVYSREVIIRDRNRFHHFREGRCSCNDYW 621 >ref|XP_006364594.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Solanum tuberosum] Length = 621 Score = 88.6 bits (218), Expect = 8e-16 Identities = 34/47 (72%), Positives = 44/47 (93%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AK+LRICVDCH F K+LS+VY+R +++RDR+RFHHF+EG+CSCNDYW Sbjct: 575 AKDLRICVDCHNFAKILSAVYSREVVIRDRNRFHHFREGRCSCNDYW 621 >ref|XP_004301147.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Fragaria vesca subsp. vesca] Length = 643 Score = 88.2 bits (217), Expect = 1e-15 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR CVDCH F +LS VYNR +IVRDRSRFHHF+EG+CSCN YW Sbjct: 597 AKNLRTCVDCHNFAMILSGVYNRTIIVRDRSRFHHFREGRCSCNGYW 643 >tpg|DAA48971.1| TPA: selenium-binding protein-like protein [Zea mays] Length = 611 Score = 88.2 bits (217), Expect = 1e-15 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F K+ S++Y R++IVRDR+RFHHFQ G+CSCNDYW Sbjct: 565 AKNLRVCVDCHNFTKMFSAIYRRIVIVRDRTRFHHFQGGKCSCNDYW 611 >ref|NP_001148047.1| LOC100281656 [Zea mays] gi|195615502|gb|ACG29581.1| selenium-binding protein-like [Zea mays] Length = 597 Score = 88.2 bits (217), Expect = 1e-15 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F K+ S++Y R++IVRDR+RFHHFQ G+CSCNDYW Sbjct: 551 AKNLRVCVDCHNFTKMFSAIYRRIVIVRDRTRFHHFQGGKCSCNDYW 597 >gb|EMJ11463.1| hypothetical protein PRUPE_ppa003212mg [Prunus persica] Length = 592 Score = 87.8 bits (216), Expect = 1e-15 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLRICVDCH F VLS VYNR +I+RDR+RFHHF+EG+CSCN YW Sbjct: 546 AKNLRICVDCHNFAMVLSGVYNREVIIRDRTRFHHFREGRCSCNGYW 592 >gb|EOY21867.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 640 Score = 87.4 bits (215), Expect = 2e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +3 Query: 6 KNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 KNLRICVDCH F K LS VYNR +I+RDR+RFHHF++G CSCNDYW Sbjct: 595 KNLRICVDCHNFAKFLSGVYNRKVIIRDRTRFHHFRDGGCSCNDYW 640 >ref|XP_004155062.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like [Cucumis sativus] Length = 602 Score = 87.4 bits (215), Expect = 2e-15 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 A N+R C+DCH F K +SSVYNR ++VRDRSRFHHFQEG+CSCND+W Sbjct: 556 ANNIRTCMDCHNFAKYISSVYNRKVVVRDRSRFHHFQEGRCSCNDFW 602 >ref|XP_004974732.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g47530-like [Setaria italica] Length = 533 Score = 86.7 bits (213), Expect = 3e-15 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +3 Query: 3 AKNLRICVDCHTFCKVLSSVYNRLLIVRDRSRFHHFQEGQCSCNDYW 143 AKNLR+CVDCH F K+ S +YNRL+IVRDR+RFHH + G+CSCNDYW Sbjct: 487 AKNLRVCVDCHNFTKLFSGIYNRLVIVRDRTRFHHCEGGKCSCNDYW 533