BLASTX nr result
ID: Stemona21_contig00043204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00043204 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX93158.1| 2-oxoglutarate and Fe(II)-dependent oxygenase sup... 57 3e-06 ref|XP_004233276.1| PREDICTED: hyoscyamine 6-dioxygenase-like [S... 56 6e-06 >gb|EOX93158.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein [Theobroma cacao] Length = 299 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 3 AVEPPAELVGPEHLRVYKPITVEEYRKLRLASASRAGEALSLL 131 AVEPP ELV EH R+Y P T EEYRKLRL + +AGEAL+L+ Sbjct: 253 AVEPPPELVDSEHPRLYVPFTYEEYRKLRLTTNLQAGEALALV 295 >ref|XP_004233276.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Solanum lycopersicum] Length = 301 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 3 AVEPPAELVGPEHLRVYKPITVEEYRKLRLASASRAGEALSLL 131 AVEPP ELV EH R+Y P T +YRKLRL++ +AGEAL L+ Sbjct: 255 AVEPPPELVNAEHPRIYVPFTFNDYRKLRLSTKLQAGEALDLM 297