BLASTX nr result
ID: Stemona21_contig00043034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00043034 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004141243.1| PREDICTED: uncharacterized protein LOC101211... 55 7e-06 ref|XP_002510270.1| acylamino-acid-releasing enzyme, putative [R... 55 7e-06 gb|EMS63628.1| hypothetical protein TRIUR3_32543 [Triticum urartu] 55 1e-05 >ref|XP_004141243.1| PREDICTED: uncharacterized protein LOC101211004 [Cucumis sativus] gi|449498688|ref|XP_004160606.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226296 [Cucumis sativus] Length = 734 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 523 SAYAYFYPPLNHMYQASSNEKPPLLVKSHG 434 +AYAYFYPP N YQAS NEKPPLL+KSHG Sbjct: 476 NAYAYFYPPSNPKYQASPNEKPPLLLKSHG 505 >ref|XP_002510270.1| acylamino-acid-releasing enzyme, putative [Ricinus communis] gi|223550971|gb|EEF52457.1| acylamino-acid-releasing enzyme, putative [Ricinus communis] Length = 731 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 523 SAYAYFYPPLNHMYQASSNEKPPLLVKSHG 434 +AYAYFYPP N MYQAS EKPPLL+KSHG Sbjct: 473 NAYAYFYPPSNPMYQASPEEKPPLLLKSHG 502 >gb|EMS63628.1| hypothetical protein TRIUR3_32543 [Triticum urartu] Length = 696 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -1 Query: 520 AYAYFYPPLNHMYQASSNEKPPLLVKSHG 434 AYAYFYPP NH +Q SS+EKPPLLV++HG Sbjct: 465 AYAYFYPPYNHTFQGSSDEKPPLLVRTHG 493