BLASTX nr result
ID: Stemona21_contig00042185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00042185 (336 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379787.1| hypothetical protein POPTR_0008s13800g [Popu... 58 1e-06 ref|XP_002311546.2| dihydroflavonol 4-reductase family protein [... 58 1e-06 gb|EPS73655.1| hypothetical protein M569_01100 [Genlisea aurea] 58 1e-06 gb|EOX98959.1| Dihydroflavonol 4-reductase-like1 [Theobroma cacao] 58 1e-06 ref|XP_003572382.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional... 58 1e-06 gb|EXB40460.1| hypothetical protein L484_013763 [Morus notabilis] 57 3e-06 ref|XP_002523596.1| cinnamoyl-CoA reductase, putative [Ricinus c... 56 4e-06 gb|AEZ53298.1| tetraketide alpha-pyrone reductase 1 [Nicotiana t... 56 6e-06 ref|XP_002462592.1| hypothetical protein SORBIDRAFT_02g028700 [S... 56 6e-06 gb|EMJ01599.1| hypothetical protein PRUPE_ppa008548mg [Prunus pe... 55 7e-06 gb|ESW22613.1| hypothetical protein PHAVU_005G167400g [Phaseolus... 55 1e-05 ref|XP_006849855.1| hypothetical protein AMTR_s00022p00057010 [A... 55 1e-05 gb|AFC36879.1| tetraketide alpha-pyrone reductase 1 [Nicotiana t... 55 1e-05 >ref|XP_006379787.1| hypothetical protein POPTR_0008s13800g [Populus trichocarpa] gi|550333012|gb|ERP57584.1| hypothetical protein POPTR_0008s13800g [Populus trichocarpa] Length = 329 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSK 201 HILVYE+ A GRYLCSSIVL+N ELA+ LS+RYPS RF + Sbjct: 237 HILVYEDETAGGRYLCSSIVLDNDELASFLSQRYPSLPIPKRFEQ 281 >ref|XP_002311546.2| dihydroflavonol 4-reductase family protein [Populus trichocarpa] gi|550333011|gb|EEE88913.2| dihydroflavonol 4-reductase family protein [Populus trichocarpa] Length = 320 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSK 201 HILVYE+ A GRYLCSSIVL+N ELA+ LS+RYPS RF + Sbjct: 228 HILVYEDETAGGRYLCSSIVLDNDELASFLSQRYPSLPIPKRFEQ 272 >gb|EPS73655.1| hypothetical protein M569_01100 [Genlisea aurea] Length = 359 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSKKA 195 HI+VYE A+GRY+CSS VL N ELAA+LS RYP+ RF K A Sbjct: 237 HIMVYEKDNAEGRYICSSAVLENDELAAILSHRYPTLPIPRRFEKAA 283 >gb|EOX98959.1| Dihydroflavonol 4-reductase-like1 [Theobroma cacao] Length = 357 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRF 207 HILVYE+ A GRYLCSS V++N ELAA+LS RYPS + RF Sbjct: 262 HILVYEHEAANGRYLCSSTVIDNDELAAILSARYPSLTVPKRF 304 >ref|XP_003572382.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Brachypodium distachyon] Length = 360 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPS 228 HILVYE A A+GRY+C+S VL+N+EL ALL+KRYPS Sbjct: 270 HILVYETAGARGRYICNSAVLDNNELVALLAKRYPS 305 >gb|EXB40460.1| hypothetical protein L484_013763 [Morus notabilis] Length = 100 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSK 201 HILVYE+ A GRYLCSS V++N++LA+ LS RYPS S RF + Sbjct: 13 HILVYEDKDAHGRYLCSSTVIDNNDLASFLSARYPSLSAPKRFEQ 57 >ref|XP_002523596.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223537158|gb|EEF38791.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 328 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSK 201 HILVYE A+GRY+CSS +L+N+EL + LS RYPS S RF + Sbjct: 237 HILVYEQENARGRYICSSTILDNNELVSFLSARYPSLSIPKRFEQ 281 >gb|AEZ53298.1| tetraketide alpha-pyrone reductase 1 [Nicotiana tabacum] Length = 337 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSK 201 HILVYE+ A GRYLCSS VL+N++L ++LS+RYPS RF K Sbjct: 250 HILVYEHPDAHGRYLCSSKVLDNNQLVSILSERYPSLPIPKRFKK 294 >ref|XP_002462592.1| hypothetical protein SORBIDRAFT_02g028700 [Sorghum bicolor] gi|241925969|gb|EER99113.1| hypothetical protein SORBIDRAFT_02g028700 [Sorghum bicolor] Length = 329 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYP 231 HILVYE A GRYLCSS+VL+N EL +LL+KRYP Sbjct: 239 HILVYETPHATGRYLCSSVVLDNDELVSLLAKRYP 273 >gb|EMJ01599.1| hypothetical protein PRUPE_ppa008548mg [Prunus persica] Length = 327 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSK 201 HI VYE+ A GRYLCSS VL+N+ELA+LLS++YPS RF + Sbjct: 241 HISVYEHESAHGRYLCSSTVLDNNELASLLSRQYPSLPIPKRFEQ 285 >gb|ESW22613.1| hypothetical protein PHAVU_005G167400g [Phaseolus vulgaris] Length = 323 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -2 Query: 332 ILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSK 201 ILVYE+ + GRYLCSS+V+N +LAALL+ RYP+ S RF K Sbjct: 235 ILVYEDEGSHGRYLCSSVVMNEDDLAALLANRYPTLSISPRFEK 278 >ref|XP_006849855.1| hypothetical protein AMTR_s00022p00057010 [Amborella trichopoda] gi|548853453|gb|ERN11436.1| hypothetical protein AMTR_s00022p00057010 [Amborella trichopoda] Length = 320 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPS 228 H+LVYE+A+A+GRYLCSS +L N+EL + L +RYP+ Sbjct: 237 HVLVYEDAKAKGRYLCSSTILENYELTSFLKERYPN 272 >gb|AFC36879.1| tetraketide alpha-pyrone reductase 1 [Nicotiana tabacum] Length = 337 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -2 Query: 335 HILVYENARAQGRYLCSSIVLNNHELAALLSKRYPSRSQRGRFSK 201 HILVYE+ A GRYLCSS VL+N++L +LS+RYPS RF K Sbjct: 250 HILVYEHPDAHGRYLCSSKVLDNNQLVPILSERYPSLPIPKRFKK 294