BLASTX nr result
ID: Stemona21_contig00042063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00042063 (444 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC10645.1| hypothetical protein L484_025226 [Morus notabilis] 55 1e-05 >gb|EXC10645.1| hypothetical protein L484_025226 [Morus notabilis] Length = 480 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = +3 Query: 105 IFAIDSLSVPYGFELATLESRLAMGLNIMCVLADGMDFNVAKAMRATS 248 +FA+DSL VPYGF+L E+R +GLNI VL DG +FNVA +M + S Sbjct: 178 VFALDSLLVPYGFDLMASETRPPLGLNITKVLIDGHNFNVAASMLSAS 225