BLASTX nr result
ID: Stemona21_contig00040383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00040383 (373 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY25061.1| FtsH extracellular protease family isoform 2 [The... 58 1e-06 gb|EOY25060.1| FtsH extracellular protease family isoform 1 [The... 58 1e-06 gb|EMJ11592.1| hypothetical protein PRUPE_ppa000962mg [Prunus pe... 58 1e-06 ref|XP_002509985.1| Cell division protein ftsH, putative [Ricinu... 58 1e-06 ref|XP_003532440.2| PREDICTED: ATP-dependent zinc metalloproteas... 58 1e-06 ref|XP_006476360.1| PREDICTED: ATP-dependent zinc metalloproteas... 58 1e-06 gb|ESW32175.1| hypothetical protein PHAVU_002G299700g [Phaseolus... 58 1e-06 ref|XP_006439320.1| hypothetical protein CICLE_v10018718mg [Citr... 58 1e-06 ref|XP_006439319.1| hypothetical protein CICLE_v10018718mg [Citr... 58 1e-06 ref|XP_006439318.1| hypothetical protein CICLE_v10018718mg [Citr... 58 1e-06 gb|EXC24703.1| ATP-dependent zinc metalloprotease FtsH [Morus no... 57 2e-06 ref|XP_006852630.1| hypothetical protein AMTR_s00021p00235220 [A... 57 3e-06 gb|EOY25063.1| FtsH extracellular protease family isoform 4, par... 57 3e-06 ref|XP_004503606.1| PREDICTED: ATP-dependent zinc metalloproteas... 56 6e-06 ref|XP_006413491.1| hypothetical protein EUTSA_v10024337mg [Eutr... 55 7e-06 ref|XP_004300881.1| PREDICTED: ATP-dependent zinc metalloproteas... 55 1e-05 ref|XP_002299463.1| hypothetical protein POPTR_0001s10780g [Popu... 55 1e-05 >gb|EOY25061.1| FtsH extracellular protease family isoform 2 [Theobroma cacao] Length = 896 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 737 QTLSQVVFHRLDDESYMFERRPQLLHRLQV 766 >gb|EOY25060.1| FtsH extracellular protease family isoform 1 [Theobroma cacao] Length = 948 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 737 QTLSQVVFHRLDDESYMFERRPQLLHRLQV 766 >gb|EMJ11592.1| hypothetical protein PRUPE_ppa000962mg [Prunus persica] Length = 948 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 735 QTLSQVVFHRLDDESYMFERRPQLLHRLQV 764 >ref|XP_002509985.1| Cell division protein ftsH, putative [Ricinus communis] gi|223549884|gb|EEF51372.1| Cell division protein ftsH, putative [Ricinus communis] Length = 925 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 717 QTLSQVVFHRLDDESYMFERRPQLLHRLQV 746 >ref|XP_003532440.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like [Glycine max] Length = 926 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 717 QTLSQLVFHRLDDESYMFERRPQLLHRLQV 746 >ref|XP_006476360.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like isoform X1 [Citrus sinensis] Length = 938 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 727 QTLSQLVFHRLDDESYMFERRPQLLHRLQV 756 >gb|ESW32175.1| hypothetical protein PHAVU_002G299700g [Phaseolus vulgaris] Length = 919 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 711 QTLSQLVFHRLDDESYMFERRPQLLHRLQV 740 >ref|XP_006439320.1| hypothetical protein CICLE_v10018718mg [Citrus clementina] gi|557541582|gb|ESR52560.1| hypothetical protein CICLE_v10018718mg [Citrus clementina] Length = 938 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 727 QTLSQLVFHRLDDESYMFERRPQLLHRLQV 756 >ref|XP_006439319.1| hypothetical protein CICLE_v10018718mg [Citrus clementina] gi|557541581|gb|ESR52559.1| hypothetical protein CICLE_v10018718mg [Citrus clementina] Length = 807 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 727 QTLSQLVFHRLDDESYMFERRPQLLHRLQV 756 >ref|XP_006439318.1| hypothetical protein CICLE_v10018718mg [Citrus clementina] gi|557541580|gb|ESR52558.1| hypothetical protein CICLE_v10018718mg [Citrus clementina] Length = 970 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQV Sbjct: 727 QTLSQLVFHRLDDESYMFERRPQLLHRLQV 756 >gb|EXC24703.1| ATP-dependent zinc metalloprotease FtsH [Morus notabilis] Length = 950 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFERRPQLLHRLQ+ Sbjct: 739 QTLSQLVFHRLDDESYMFERRPQLLHRLQI 768 >ref|XP_006852630.1| hypothetical protein AMTR_s00021p00235220 [Amborella trichopoda] gi|548856241|gb|ERN14097.1| hypothetical protein AMTR_s00021p00235220 [Amborella trichopoda] Length = 969 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QT SQIVFHR D+E YMFERRPQLLHRLQV Sbjct: 772 QTYSQIVFHRLDDEAYMFERRPQLLHRLQV 801 >gb|EOY25063.1| FtsH extracellular protease family isoform 4, partial [Theobroma cacao] Length = 722 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQ 140 QTLSQ+VFHR D+E YMFERRPQLLHRLQ Sbjct: 694 QTLSQVVFHRLDDESYMFERRPQLLHRLQ 722 >ref|XP_004503606.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Cicer arietinum] Length = 919 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTL Q+VFHR D+E YMFERRPQLLHRLQV Sbjct: 710 QTLCQLVFHRLDDESYMFERRPQLLHRLQV 739 >ref|XP_006413491.1| hypothetical protein EUTSA_v10024337mg [Eutrema salsugineum] gi|557114661|gb|ESQ54944.1| hypothetical protein EUTSA_v10024337mg [Eutrema salsugineum] Length = 943 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMF RRPQLLHRLQV Sbjct: 729 QTLSQVVFHRLDDESYMFGRRPQLLHRLQV 758 >ref|XP_004300881.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Fragaria vesca subsp. vesca] Length = 933 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VF R D+E YMFERRPQLLHRLQV Sbjct: 722 QTLSQVVFDRLDDEAYMFERRPQLLHRLQV 751 >ref|XP_002299463.1| hypothetical protein POPTR_0001s10780g [Populus trichocarpa] gi|222846721|gb|EEE84268.1| hypothetical protein POPTR_0001s10780g [Populus trichocarpa] Length = 932 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 226 QTLSQIVFHRFDEELYMFERRPQLLHRLQV 137 QTLSQ+VFHR D+E YMFER PQLLHRLQV Sbjct: 721 QTLSQLVFHRLDDESYMFERLPQLLHRLQV 750