BLASTX nr result
ID: Stemona21_contig00040357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00040357 (583 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX93960.1| hypothetical chloroplast RF21 (chloroplast) [Aphy... 80 3e-13 gb|AEX93948.1| hypothetical chloroplast RF21 (chloroplast) [Eche... 79 8e-13 gb|AHI87572.1| hypothetical chloroplast RF21 (chloroplast) [Chio... 79 1e-12 ref|YP_008993735.1| hypothetical chloroplast RF21 (chloroplast) ... 79 1e-12 ref|YP_008994116.1| hypothetical chloroplast RF2 (chloroplast) [... 79 1e-12 ref|YP_008993907.1| hypothetical chloroplast RF21 (chloroplast) ... 79 1e-12 ref|YP_008993821.1| hypothetical chloroplast RF21 (chloroplast) ... 79 1e-12 ref|YP_008993649.1| hypothetical chloroplast RF21 (chloroplast) ... 79 1e-12 ref|YP_008993391.1| hypothetical chloroplast RF21 (chloroplast) ... 79 1e-12 ref|YP_008993219.1| hypothetical chloroplast RF21 (chloroplast) ... 79 1e-12 ref|YP_008994333.1| hypothetical chloroplast RF21 [Melianthus vi... 79 1e-12 gb|AHA13226.1| hypothetical chloroplast RF21 [Thaumatococcus dan... 79 1e-12 gb|AHA12968.1| hypothetical chloroplast RF21 [Monocostus uniflor... 79 1e-12 gb|AHA12799.1| hypothetical chloroplast RF21 [Canna indica] gi|5... 79 1e-12 ref|YP_008854469.1| hypothetical chloroplast RF21 [Musa textilis... 79 1e-12 ref|YP_008758231.1| Ycf2 (chloroplast) [Veratrum patulum] gi|556... 79 1e-12 gb|AGQ55800.1| hypothetical chloroplast RF21 (chloroplast) [Lili... 79 1e-12 gb|AGQ55715.1| hypothetical chloroplast RF21 (chloroplast) [Alst... 79 1e-12 ref|YP_008578329.1| hypothetical chloroplast RF21 (chloroplast) ... 79 1e-12 emb|CCW72420.1| ycf2 (chloroplast) [Musa acuminata subsp. malacc... 79 1e-12 >gb|AEX93960.1| hypothetical chloroplast RF21 (chloroplast) [Aphyllanthes monspeliensis] Length = 2271 Score = 80.5 bits (197), Expect = 3e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGFYLEKK Sbjct: 1773 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFYLEKK 1812 >gb|AEX93948.1| hypothetical chloroplast RF21 (chloroplast) [Echeandia sp. Steele 1101] Length = 2253 Score = 79.0 bits (193), Expect = 8e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQ+KYFFILSYTRGF+LEKK Sbjct: 1778 ALIAPNKLNTCIKIRRLLIPQQQKYFFILSYTRGFHLEKK 1817 >gb|AHI87572.1| hypothetical chloroplast RF21 (chloroplast) [Chionographis japonica] gi|584297243|gb|AHI87589.1| hypothetical chloroplast RF21 (chloroplast) [Chionographis japonica] Length = 2305 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1789 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1828 >ref|YP_008993735.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia salicifolia] gi|573972436|ref|YP_008993754.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia salicifolia] Length = 2298 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1794 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1833 >ref|YP_008994116.1| hypothetical chloroplast RF2 (chloroplast) [Fritillaria taipaiensis] gi|570700473|ref|YP_008994133.1| hypothetical chloroplast RF2 (chloroplast) [Fritillaria taipaiensis] gi|474452236|gb|AGI51288.1| hypothetical chloroplast RF2 (chloroplast) [Fritillaria taipaiensis] gi|474452253|gb|AGI51305.1| hypothetical chloroplast RF2 (chloroplast) [Fritillaria taipaiensis] gi|500050384|gb|AGL80047.1| hypothetical chloroplast RF2 (chloroplast) [Fritillaria taipaiensis] gi|500050402|gb|AGL80065.1| hypothetical chloroplast RF2 (chloroplast) [Fritillaria taipaiensis] gi|500050476|gb|AGL80134.1| hypothetical chloroplast RF2 (chloroplast) [Fritillaria taipaiensis] gi|500050494|gb|AGL80152.1| hypothetical chloroplast RF2 (chloroplast) [Fritillaria taipaiensis] Length = 2217 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1717 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1756 >ref|YP_008993907.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sprengeri] gi|570772356|ref|YP_008993926.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sprengeri] Length = 2298 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1794 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1833 >ref|YP_008993821.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sinica] gi|570772258|ref|YP_008993840.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia sinica] Length = 2298 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1794 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1833 >ref|YP_008993649.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia odora] gi|570760248|ref|YP_008993668.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia odora] Length = 2298 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1794 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1833 >ref|YP_008993391.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia pyramidata] gi|570759987|ref|YP_008993410.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia pyramidata] Length = 2298 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1794 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1833 >ref|YP_008993219.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia cathcartii] gi|570759813|ref|YP_008993238.1| hypothetical chloroplast RF21 (chloroplast) [Magnolia cathcartii] Length = 2298 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1794 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1833 >ref|YP_008994333.1| hypothetical chloroplast RF21 [Melianthus villosus] gi|570880075|ref|YP_008994347.1| hypothetical chloroplast RF21 [Melianthus villosus] gi|527355182|gb|AGS13051.1| hypothetical chloroplast RF21 [Melianthus villosus] gi|527355198|gb|AGS13067.1| hypothetical chloroplast RF21 [Melianthus villosus] Length = 2307 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRKYFF LSYTRGF+LEKK Sbjct: 1814 ALIAPNKLNTCIKIRRLLIPQQRKYFFTLSYTRGFHLEKK 1853 >gb|AHA13226.1| hypothetical chloroplast RF21 [Thaumatococcus daniellii] Length = 2277 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1776 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1815 >gb|AHA12968.1| hypothetical chloroplast RF21 [Monocostus uniflorus] gi|557637389|gb|AHA12986.1| hypothetical chloroplast RF21 [Monocostus uniflorus] Length = 2293 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1793 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1832 >gb|AHA12799.1| hypothetical chloroplast RF21 [Canna indica] gi|557637218|gb|AHA12817.1| hypothetical chloroplast RF21 [Canna indica] Length = 2316 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1811 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1850 >ref|YP_008854469.1| hypothetical chloroplast RF21 [Musa textilis] gi|563940614|ref|YP_008854486.1| hypothetical chloroplast RF21 [Musa textilis] gi|557636956|gb|AHA12558.1| hypothetical chloroplast RF21 [Musa textilis] gi|557636974|gb|AHA12576.1| hypothetical chloroplast RF21 [Musa textilis] Length = 2307 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1818 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1857 >ref|YP_008758231.1| Ycf2 (chloroplast) [Veratrum patulum] gi|556927295|ref|YP_008758248.1| Ycf2 (chloroplast) [Veratrum patulum] gi|549531760|gb|AGX28886.1| Ycf2 (chloroplast) [Veratrum patulum] gi|549531780|gb|AGX28906.1| Ycf2 (chloroplast) [Veratrum patulum] Length = 2284 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1782 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1821 >gb|AGQ55800.1| hypothetical chloroplast RF21 (chloroplast) [Lilium longiflorum] gi|523706833|gb|AGQ55816.1| hypothetical chloroplast RF21 (chloroplast) [Lilium longiflorum] Length = 2209 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1709 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1748 >gb|AGQ55715.1| hypothetical chloroplast RF21 (chloroplast) [Alstroemeria aurea] gi|523706747|gb|AGQ55731.1| hypothetical chloroplast RF21 (chloroplast) [Alstroemeria aurea] Length = 2280 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1781 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1820 >ref|YP_008578329.1| hypothetical chloroplast RF21 (chloroplast) [Cocos nucifera] gi|546138119|ref|YP_008578346.1| hypothetical chloroplast RF21 (chloroplast) [Cocos nucifera] gi|528748819|gb|AGS43509.1| hypothetical chloroplast RF21 (chloroplast) [Cocos nucifera] gi|528748836|gb|AGS43526.1| hypothetical chloroplast RF21 (chloroplast) [Cocos nucifera] Length = 2294 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1794 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1833 >emb|CCW72420.1| ycf2 (chloroplast) [Musa acuminata subsp. malaccensis] gi|525312522|emb|CCW72445.1| ycf2 (chloroplast) [Musa acuminata subsp. malaccensis] Length = 2336 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ALIAPNKLNTCIKIQRLLIPQQRKYFFILSYTRGFYLEKK 122 ALIAPNKLNTCIKI+RLLIPQQRK+FFILSYTRGF+LEKK Sbjct: 1835 ALIAPNKLNTCIKIRRLLIPQQRKHFFILSYTRGFHLEKK 1874